IED Industry Enzyme Database

Detail Information for IndEnz0002015472
IED ID IndEnz0002015472
Enzyme Type ID protease015472
Protein Name Myc protein
Diminutive protein
dMyc1
Gene Name Myc dm CG10798
Organism Drosophila melanogaster (Fruit fly)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Ephydroidea Drosophilidae (pomace flies) Drosophilinae Drosophilini Drosophila (fruit flies) Sophophora melanogaster group melanogaster subgroup Drosophila melanogaster (Fruit fly)
Enzyme Sequence MALYRSDPYSIMDDQLFSNISIFDMDNDLYDMDKLLSSSTIQSDLEKIEDMESVFQDYDLEEDMKPEIRNIDCMWPAMSSCLTSGNGNGIESGNSAASSYSETGAVSLAMVSGSTNLYSAYQRSQTTDNTQSNQQHVVNSAENMPVIIKKELADLDYTVCQKRLRLSGGDKKSQIQDEVHLIPPGGSLLRKRNNQDIIRKSGELSGSDSIKYQRPDTPHSLTDEVAASEFRHNVDLRACVMGSNNISLTGNDSDVNYIKQISRELQNTGKDPLPVRYIPPINDVLDVLNQHSNSTGGQQQLNQQQLDEQQQAIDIATGRNTVDSPPTTGSDSDSDDGEPLNFDLRHHRTSKSGSNASITTNNNNSNNKNNKLKNNSNGMLHMMHITDHSYTRCNDMVDDGPNLETPSDSDEEIDVVSYTDKKLPTNPSCHLMGALQFQMAHKISIDHMKQKPRYNNFNLPYTPASSSPVKSVANSRYPSPSSTPYQNCSSASPSYSPLSVDSSNVSSSSSSSSSQSSFTTSSSNKGRKRSSLKDPGLLISSSSVYLPGVNNKVTHSSMMSKKSRGKKVVGTSSGNTSPISSGQDVDAMDRNWQRRSGGIATSTSSNSSVHRKDFVLGFDEADTIEKRNQHNDMERQRRIGLKNLFEALKKQIPTIRDKERAPKVNILREAAKLCIQLTQEEKELSMQRQLLSLQLKQRQDTLASYQMELNESRSVSG
Enzyme Length 717
Uniprot Accession Number Q9W4S7
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Participates in the regulation of gene transcription (PubMed:8929412, PubMed:16087886, PubMed:24173801, PubMed:24615015, PubMed:25999153, PubMed:25858587). Binds DNA in a non-specific manner, yet also specifically recognizes the core sequence CAC[GA]TG (PubMed:8929412). Seems to activate the transcription of growth-related genes; required for cellular proliferation and growth (PubMed:16087886, PubMed:25999153, PubMed:25858587). Functions in the TORC2-mediated regulation of cell growth, acting downstream of the TORC2 complex (PubMed:25999153). Inhibits the demethylase activity of Lid (PubMed:17311883). Activates transcription of mbm (PubMed:24615015). Has a role in ribosome biogenesis and endoreplication in fat body cells by activating the transcription of LTV1 (PubMed:25858587). Able to induce the SCF E3 ubiquitin-protein ligase member archipelago (ago) which functions in its degradation (PubMed:15182669, PubMed:24173801). It may therefore create a negative feedback loop with ago that is regulated by the ubiquitin hydrolase puf (PubMed:24173801). {ECO:0000269|PubMed:15182669, ECO:0000269|PubMed:16087886, ECO:0000269|PubMed:17311883, ECO:0000269|PubMed:24173801, ECO:0000269|PubMed:24615015, ECO:0000269|PubMed:25858587, ECO:0000269|PubMed:25999153, ECO:0000269|PubMed:8929412}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Coiled coil (1); Compositional bias (4); Domain (1); Modified residue (2); Region (3); Sequence conflict (4)
Keywords Activator;Coiled coil;Cytoplasm;DNA-binding;Nucleus;Phosphoprotein;Reference proteome;Transcription;Transcription regulation;Ubl conjugation
Interact With Q9VZF4; P16371; P16371-2; P91664; Q9VH07; Q9V3K3
Induction
Subcellular Location SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:25999153}. Cytoplasm {ECO:0000269|PubMed:25999153}. Note=Translocation from the cytoplasm to the nucleus may be promoted by the TORC2 complex (Lst8 and rictor). {ECO:0000269|PubMed:25999153}.
Modified Residue MOD_RES 217; /note=Phosphothreonine; /evidence=ECO:0000269|PubMed:18327897; MOD_RES 220; /note=Phosphoserine; /evidence=ECO:0000269|PubMed:18327897
Post Translational Modification PTM: Probably targeted for ubiquitination by the SFC ubiquitin ligase complex member ago, leading to its proteasomal degradation. {ECO:0000305|PubMed:15182669}.
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 10072360; 10499795; 10607581; 10637629; 10679387; 10693760; 10786767; 10839352; 10862736; 10934032; 10935514; 10980431; 10996806; 11128988; 11146648; 11163146; 11223030; 11337472; 11348589; 11348591; 11377964; 11546747; 11698190; 11744370; 11782950; 11807027; 11832249; 12200162; 12208851; 12324961; 12695332; 12730130; 12834864; 12932322; 13512754; 13678953; 13830957; 14523394; 14551319; 14605208; 14616073; 14623438; 14667407; 14724122; 14764878; 14993190; 15001704; 15066286; 15066287; 15071581; 15084254; 15084262; 15090076; 15128666; 15175253; 15182690; 15187232; 15296714; 15304339; 15454083; 15520277; 15574590; 15589139; 15652705; 15661536; 15692573; 15723055; 15766758; 15831447; 16055719; 16118195; 16243018; 16260605; 16314564; 16357214; 16359857; 16387886; 16463014; 16496002; 16503134; 16564003; 16564014; 16582602; 16603075; 16611691; 16672346; 16794031; 16916612; 16923381; 16949821; 17028317; 17029562; 17055987; 17182870; 17199047; 17246329; 17246888; 17246989; 17322403; 17335570; 17519021; 17574031; 17645804; 17720938; 1783293; 17898168; 17963749; 17976568; 17994084; 18000039; 18083103; 18177722; 18241851; 18257071; 18371420; 18451803; 18514182; 18528333; 18557763; 18614577; 18670627; 18690062; 18721782; 18783608; 18836313; 18854141; 18957936; 18987026; 19029797; 19073139; 19141596; 19165923; 19176515; 19211674; 19211682; 19214224; 19248823; 19317915; 19333393; 19364825; 19502489; 19531351; 19531584; 19723762; 19733076; 19733656; 19742324; 19787055; 19854354; 19855819; 19887915; 19897747; 19923887; 1996129; 20007327; 20089194; 20130677; 20162636; 20220848; 20371351; 20374622; 20400939; 20418542; 20430750; 20432470; 20553708; 20610485; 20627080; 20627082; 20644714; 20667914; 20679206; 20679484; 20876565; 20885789; 20925960; 20937797; 20951343; 20951347; 21074052; 21124823; 21177347; 21187160; 21215926; 21215937; 21220321; 21238926; 21239477; 21245665; 21288872; 21333734; 21338344; 21478632; 21482673; 21483452; 21538561; 21546910; 21555458; 21596792; 21603606; 21763605; 21795284; 21808241; 21811580; 21839923; 21886841; 21951762; 21962715; 22061480; 22069188; 22095083; 22117545; 22190460; 22190496; 22215808; 22267917; 22331866; 22367393; 22438831; 22503687; 22549587; 22589731; 22683826; 22830020; 22848598; 22890320; 22948071; 22960233; 22992954; 23071443; 23166712; 23172913; 23213460; 23228366; 23232763; 232452; 23251396; 23316440; 23336071; 23337628; 23357222; 23403565; 23444356; 23459416; 23509066; 23583758; 23608455; 23685249; 23696362; 23708122; 23761963; 23791523; 23818863; 23836429; 23896988; 23944235; 23950728; 23962978; 24040302; 24066226; 24069565; 24069566; 24086064; 24205337; 24275942; 24291519; 24352421; 24353210; 24366875; 24395559; 24550108; 24550726; 24561262; 24583474; 24618901; 24626201; 24685611; 24685612; 24692189; 24696456; 24766377; 24768030; 24813173; 24819984; 24892918; 24902665; 24902837; 24924190; 24931167; 24949430; 24965943; 24985916; 24990993; 25010747; 25012699; 25022356; 25073156; 25092766; 25164757; 25217223; 25280996; 25293339; 25294943; 25313405; 25393288; 25412630; 25481477; 25497380; 25568052; 25593306; 25601460; 25605786; 25619598; 25680814; 25751057; 25762498; 25796446; 25888431; 25888729; 25922346; 25977368; 25994086; 26041767; 26074141; 26117322; 26118647; 26170449; 26173873; 26198204; 26207831; 26215099; 26287461; 26374529; 26408093; 26517923; 26527002; 26544867; 26550828; 26551273; 26607382; 26631518; 26650355; 26658841; 26700685; 26721418; 26811379; 26827889; 26840050; 26853359; 26853366; 26855015; 26866694; 26889675; 26972460; 27000837; 27066183; 27097273; 27137186; 27172095; 27193394; 27207882; 27298020; 27319281; 27394031; 27450801; 27476594; 27501445; 27604692; 27626673; 27693629; 27848019; 28059623; 28064166; 28068320; 28077491; 28123053; 28143945; 28150056; 28196804; 28242614; 28267791; 28316031; 28350299; 28363744; 28376317; 28398229; 28406902; 28420161; 28452935; 28472194; 28476867; 28485389; 28514643; 28515050; 28520736; 28529046; 28592498; 28600967; 28620086; 28642244; 28700947; 28841136; 28919436; 29065309; 29066546; 29078288; 29158441; 29191977; 29250773; 29262535; 29316439; 29324742; 29358748; 29401457; 29431244; 29438012; 29440220; 29445734; 29462618; 29462894; 29498662; 29504896; 29563503; 29602952; 29660312; 29670104; 29693007; 29750169; 29854726; 29854765; 29938758; 29997178; 30031756; 30078730; 30146479; 30247122; 30257867; 30261639; 30300589; 30383747; 30383748; 30389852; 30513308; 30526477; 30597983; 30619451; 30635270; 30804004; 30853556; 30881374; 3089870; 30905770; 30912203; 3091446; 30986429; 30995488; 31006647; 31063760; 31063813; 31064860; 31128299; 31227525; 31242135; 31246542; 31259690; 31262815; 31263078; 31315896; 31315941; 31425511; 31495693; 31520348; 31520352; 31520355; 31520357; 31543447; 31591186; 31612862; 31649115; 31715291; 31722196; 31722958; 31889425; 31915294; 31917525; 31934860; 31941704; 31963603; 31975175; 32009293; 32029551; 32072503; 32098783; 32182338; 32246948; 32312269; 32322015; 32328630; 32376880; 32418713; 32490812; 32509789; 32516570; 32516899; 32527935; 32540914; 32544407; 32552730; 32554565; 32567155; 32594913; 32605129; 32637412; 32722007; 32738036; 32765209; 32778819; 32810129; 32816915; 32822370; 32878880; 32899412; 32901612; 32932867; 32941799; 33023929; 33028612; 33063715; 33086384; 33159074; 33199523; 33233821; 33234715; 33275812; 33355119; 33410890; 33547043; 33549549; 33581137; 33651466; 33659837; 33683366; 33729157; 33742110; 33753080; 33775694; 33782689; 33795238; 33861361; 33907499; 33920158; 34012959; 34082046; 34146686; 34190316; 34240146; 34262912; 34290618; 34484226; 3923338; 4209397; 6300868; 6408464; 6806144; 6813058; 8536972; 9716523;
Motif
Gene Encoded By
Mass 79,308
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda