| IED ID | IndEnz0002015537 |
| Enzyme Type ID | protease015537 |
| Protein Name |
Non-hemolytic enterotoxin 105 kDa component Nhe EC 3.4.24.- Fragment |
| Gene Name | |
| Organism | Bacillus cereus |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus cereus group Bacillus cereus |
| Enzyme Sequence | EEKVPYNVLKTKPVGIEKSVDEVGHISKVDETLSFQERLKGDFSQRPASITKKTAVKQVKESYSMADLNKMNDRELVETLGSIKWHQYTDL |
| Enzyme Length | 91 |
| Uniprot Accession Number | P81242 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: This protein is a metalloprotease with gelatinolytic and collagenolytic activity and is a component of the non-hemolytic enterotoxin complex (NHE). |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-terminal residue (1) |
| Keywords | Direct protein sequencing;Enterotoxin;Hydrolase;Metal-binding;Metalloprotease;Protease;Secreted;Toxin;Virulence;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 10,412 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |