| IED ID | IndEnz0002015544 |
| Enzyme Type ID | protease015544 |
| Protein Name |
Salivary cystatin-L Sialostatin L SialoL |
| Gene Name | IscW_ISCW018603 |
| Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Acari Parasitiformes Ixodida (ticks) Ixodoidea Ixodidae (hardbacked ticks) Ixodinae Ixodes Ixodes scapularis (Black-legged tick) (Deer tick) |
| Enzyme Sequence | MTSSFALVLLLGGVAVCVATGVFGGYSERANHQANPEFLNLAHYATSTWSAQQPGKTHFDTVAEVLKVETQVVAGTNYRLTLKVAESTCELTSTYNKDTCLPKADAAHRTCTTVVFESLQGDKSVSSFECEAA |
| Enzyme Length | 133 |
| Uniprot Accession Number | B7PKZ2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of cysteine proteinases. Inhibits host immune responses via its inhibition of host cathepsins. Contributes to the suppression of the host's immune response to tick salivary proteins and is important for successful feeding on hosts. Inhibits differentiation of host dendritic cells. Inhibits proliferation of host T-cells in response to antigen stimulus. Down-regulates TLR2-mediated host responses to infection by B.burgdorferi and the production of the chemokine CCL3 by host dendritic cells. Down-regulates host responses to infection by B.burgdorferi and the production of IFNB1 by host dendritic cells. Down-regulates IL1B production by host mast cells, and this then leads to impaired activation of IL1R1, resulting in decreased IL9 production. Inhibits host inflammatory reactions and recruitment of host neutrophils. Inhibits papain and cathepsin L (CTSL) (in vitro). Inhibits cathepsin S (CTSS) (in vitro). Inhibits CTSV and CTSC, but to a lesser degree (in vitro). {ECO:0000250|UniProtKB:Q8MVB6}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Domain (1); Signal peptide (1); Site (1) |
| Keywords | Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:Q8MVB6}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 14,213 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |