| IED ID |
IndEnz0002015547 |
| Enzyme Type ID |
protease015547 |
| Protein Name |
Drosomycin
Cysteine-rich peptide
|
| Gene Name |
Drs CRP CG10810 |
| Organism |
Drosophila melanogaster (Fruit fly) |
| Taxonomic Lineage |
cellular organisms
Eukaryota
Opisthokonta
Metazoa
Eumetazoa
Bilateria
Protostomia
Ecdysozoa
Panarthropoda
Arthropoda
Mandibulata
Pancrustacea
Hexapoda
Insecta
Dicondylia
Pterygota (winged insects)
Neoptera
Endopterygota
Diptera
Brachycera
Muscomorpha
Eremoneura
Cyclorrhapha
Schizophora
Acalyptratae
Ephydroidea
Drosophilidae (pomace flies)
Drosophilinae
Drosophilini
Drosophila (fruit flies)
Sophophora
melanogaster group
melanogaster subgroup
Drosophila melanogaster (Fruit fly)
|
| Enzyme Sequence |
MMQIKYLFALFAVLMLVVLGANEADADCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC |
| Enzyme Length |
70 |
| Uniprot Accession Number |
P41964 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Possesses antifungal activity and is active against a relatively broad spectrum of filamentous fungi (PubMed:8808632, PubMed:12872120). It inhibits spore germination at high concentrations and at low concentrations delays growth of hyphae which subsequently exhibit abnormal morphology (PubMed:7806546). Spz C-106 in the hemolymph controls expression of the antifungal peptide by acting as a ligand of Tl and inducing an intracellular signaling pathway (PubMed:8808632). Part of a psh-dependent Toll pathway, which may function in activating the systematic immune response in response to localized melanization of the tracheal system (PubMed:18854145). {ECO:0000269|PubMed:12872120, ECO:0000269|PubMed:18854145, ECO:0000269|PubMed:7806546, ECO:0000269|PubMed:8808632}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Beta strand (2); Chain (1); Disulfide bond (4); Helix (1); Propeptide (1); Signal peptide (1); Turn (2) |
| Keywords |
3D-structure;Antimicrobial;Direct protein sequencing;Disulfide bond;Fungicide;Reference proteome;Secreted;Signal |
| Interact With |
|
| Induction |
INDUCTION: Up-regulated by septic injury caused by the Gram-positive bacteria M.luteus and the fungus C.albicans, and by M.luteus or E.faecalis-derived peptidoglycans and by B.subtilis or A.oryzae proteases (PubMed:19590012). Up-regulated by Gram-negative bacteria in the respiratory epithelium (PubMed:22022271). Up-regulated in the trachea and fat body in response to tracheal melanization, either by spontaneous melanization or melanization resulting from infection by bacteria (E.coli and M.luteus) or the fungus B.bassiana (PubMed:18854145). {ECO:0000269|PubMed:18854145, ECO:0000269|PubMed:19590012, ECO:0000269|PubMed:22022271}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Secreted. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D |
NMR spectroscopy (1) |
| Cross Reference PDB |
1MYN;
|
| Mapped Pubmed ID |
10197979;
10334979;
10369678;
10409696;
10489372;
10602463;
10619029;
10636911;
10696585;
10725405;
10793472;
10802234;
10827089;
10843389;
10898983;
10921908;
10963608;
10980426;
11017107;
11050330;
11083062;
11114385;
11118328;
11156609;
11164335;
11252795;
11269502;
11283698;
11413042;
11435447;
11486054;
11560896;
11562344;
11606746;
11606776;
11703941;
11707335;
11733057;
11739510;
11742098;
11742378;
11742401;
11743586;
11751574;
11756545;
11854512;
11869341;
11872802;
11881810;
11912488;
11912489;
11943764;
12032070;
12098703;
12101100;
12217523;
12324974;
12359879;
12381665;
12408809;
12431377;
12433364;
12446795;
12464428;
12502740;
12513692;
12514104;
12524523;
12530956;
12543974;
12556495;
12692550;
12728280;
12967563;
12973300;
14557290;
14585960;
14602069;
14602922;
14603309;
14644493;
14651939;
14654000;
14673153;
14684822;
14722090;
14731387;
14731391;
14749722;
14985331;
15032585;
15037551;
15100306;
15118082;
15136717;
15157233;
15197269;
15199954;
15199956;
15314671;
15361936;
15448690;
15475297;
15489525;
15514678;
15556270;
15585858;
15695583;
15722339;
15777795;
15788564;
15791270;
15797611;
15864439;
15878994;
15894191;
15899868;
15976485;
16061795;
16061818;
16081424;
16086017;
16107793;
16163390;
16169493;
16170305;
16239149;
16248995;
16322759;
16356271;
16399077;
16404157;
16407137;
16518472;
16546082;
16611243;
16631589;
16690050;
16767093;
16782008;
16824706;
16861233;
16894030;
16906161;
16941005;
16996061;
17018283;
17024181;
17032737;
17050695;
17060622;
17068333;
17085976;
17129215;
17166233;
17227774;
17295838;
17343912;
17371595;
17381241;
17409189;
17438142;
17475494;
17509683;
17553907;
17588928;
17660749;
17681150;
17681604;
17708965;
17785540;
17803358;
17903178;
17967061;
17987029;
18039034;
18039880;
18066067;
18067683;
18077584;
18212107;
18218863;
18261909;
18308747;
18334252;
18344972;
18378641;
18390723;
18407067;
18417101;
18474356;
18538389;
18550807;
18562649;
18573871;
18583479;
18613977;
18651922;
18657321;
18689425;
18697931;
18724373;
18725632;
18775745;
18796536;
18801354;
18820477;
18833296;
18926718;
18949036;
18953338;
19033155;
19061858;
19129115;
19204732;
19218090;
19221590;
19237508;
19378452;
19453766;
19482944;
19500410;
19557185;
19574227;
19581577;
19597539;
19687202;
19718442;
19740772;
19754735;
19754738;
19763182;
19765174;
19829691;
19837371;
19861550;
19888430;
19890048;
19934223;
19939842;
20019799;
20066029;
20090753;
20117206;
20137906;
20220848;
20348097;
20375635;
20404143;
20420686;
20420852;
20421637;
20504768;
20505310;
20600624;
20624926;
20627393;
20637738;
20668515;
20679214;
20813047;
20816892;
20849943;
20865166;
21074052;
21076039;
21158756;
21203476;
21264297;
21273816;
21287549;
21288872;
21299661;
21354324;
21364998;
21386906;
21518260;
21540241;
21540243;
21576362;
21670199;
21740495;
21775770;
21873297;
21893139;
21962711;
21979942;
21987808;
21998591;
22005212;
22040305;
22118156;
22144903;
22145623;
22195968;
22210547;
22355133;
22355724;
22374403;
22427641;
22464168;
22464169;
22470576;
22496667;
22496733;
22496930;
22520468;
22549956;
22562043;
22580186;
22590528;
22606343;
22634526;
22698822;
22851689;
22902989;
22916150;
22949833;
23028562;
23037919;
23071443;
23087834;
23122660;
23203927;
23209596;
23211361;
23228366;
23236133;
23255357;
23261474;
23401590;
23453963;
23525903;
23550122;
23606512;
23613578;
23637783;
23663779;
23669073;
23831804;
23864715;
23922788;
23988573;
24002645;
24009508;
24010524;
24075010;
24077307;
24120681;
24145453;
24151578;
24210616;
24305778;
24336499;
24343480;
24361577;
24374974;
24443439;
24475130;
24631579;
24632597;
24659248;
24684830;
24694685;
24746817;
24788090;
24794300;
24818946;
24842780;
24911519;
24951729;
24956222;
25027767;
25102059;
25126050;
25142573;
25146450;
25180232;
25233341;
25245869;
25281658;
25421701;
25429067;
25473839;
25510503;
25530181;
25561714;
25601202;
25628309;
25668031;
25687947;
25880195;
25901322;
25913403;
25915418;
26090908;
26154519;
26245905;
26251827;
26322507;
26333838;
26437768;
26462024;
26508789;
26509186;
26513145;
26524764;
26627459;
26643480;
26694630;
26739560;
26748856;
26758761;
26791145;
26824654;
26843333;
26876781;
27046080;
27058248;
27152227;
27190105;
27208092;
27527593;
27631699;
27648494;
27754853;
27765624;
27770625;
27776480;
27780230;
27794539;
27871832;
27893816;
27932997;
27960592;
27974298;
27974438;
28069988;
28085885;
28102430;
28102471;
28250052;
28275054;
28438980;
28449654;
28450373;
28476910;
28579255;
28621429;
28634323;
28649857;
28706002;
28823799;
28874153;
29113026;
29141990;
29166596;
29211760;
29268741;
29394281;
29452635;
29457041;
29466376;
29637607;
29707694;
29727694;
29760446;
29804808;
29920363;
29920489;
29924997;
29942298;
30036358;
30134574;
30254027;
30305326;
30312294;
30356215;
30379824;
30463009;
30478194;
30497778;
30564440;
30605670;
30684503;
30731096;
30735676;
30765784;
30803481;
30822306;
30910908;
30919212;
30986429;
30993906;
31052481;
31080057;
31088910;
31136986;
31147740;
31160313;
31182620;
31358113;
31481676;
31504505;
31562189;
31564469;
31636642;
31648237;
31680999;
31875578;
31900346;
31904434;
31907222;
31917956;
31940717;
31941789;
31992650;
31998316;
32033486;
32063902;
32076419;
32079481;
32221286;
32267583;
32286350;
32292407;
32344511;
32396065;
32463841;
32487456;
32498733;
32612612;
32629421;
32631949;
32636795;
32656090;
32698005;
32704134;
32781380;
32791175;
32849518;
33092519;
33109529;
33151963;
33154387;
33227003;
33253201;
33319750;
33319966;
33377870;
33477373;
33555369;
33555648;
33573306;
33748138;
33800390;
33809074;
33826881;
33882275;
33914801;
33946849;
33951964;
34017079;
34126772;
34174242;
34253067;
34448472;
34452932;
34569900;
34576280;
34843450;
7568155;
7588819;
8849679;
9394624;
9405661;
9482719;
9529244;
9553105;
9584193;
9598341;
9600835;
9826701;
|
| Motif |
|
| Gene Encoded By |
|
| Mass |
7,752 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|