| IED ID | IndEnz0002015549 |
| Enzyme Type ID | protease015549 |
| Protein Name |
Intracellular proteinase inhibitor BsuPI |
| Gene Name | ipi BSU11130 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MENQEVVLSIDAIQEPEQIKFNMSLKNQSERAIEFQFSTGQKFELVVYDSEHKERYRYSKEKMFTQAFQNLTLESGETYDFSDVWKEVPEPGTYEVKVTFKGRAENLKQVQAVQQFEVK |
| Enzyme Length | 119 |
| Uniprot Accession Number | P39804 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Directly regulates the major intracellular proteinase (ISP-1) activity in vivo. Inhibits ISP-1 in the early stages of sporulation. It may be then inactivated by a membrane-bound proteinase. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (10); Chain (1); Turn (1) |
| Keywords | 3D-structure;Cytoplasm;Direct protein sequencing;Protease inhibitor;Reference proteome;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 3ISY; |
| Mapped Pubmed ID | 21630458; 24555072; |
| Motif | |
| Gene Encoded By | |
| Mass | 14,074 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |