IED ID | IndEnz0002015554 |
Enzyme Type ID | protease015554 |
Protein Name |
Protease inhibitor 2 CmPI-II Protease inhibitor-II |
Gene Name | |
Organism | Cenchritis muricatus (Beaded periwinkle) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Littorinimorpha Littorinoidea Littorinidae Cenchritis Cenchritis muricatus (Beaded periwinkle) |
Enzyme Sequence | AEDCVGRKACTREWYPVCGSDGVTYSNPCNFSAQQEQCDPNITIAHMGEC |
Enzyme Length | 50 |
Uniprot Accession Number | P84755 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Serine protease inhibitor. Strongly inhibits human neutrophil elastase and trypsin, also inhibits porcine pancreatic elastase and subtilisin A. Does not inhibit chymotrypsin, plasma kallikrein, pancreatic kallikrein, thrombin or papain. {ECO:0000269|PubMed:16546427, ECO:0000269|PubMed:17976011}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Beta strand (3); Chain (1); Disulfide bond (2); Domain (1); Glycosylation (2); Helix (1); Site (1); Turn (1) |
Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Glycoprotein;Protease inhibitor;Serine protease inhibitor |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | NMR spectroscopy (1) |
Cross Reference PDB | 2N71; |
Mapped Pubmed ID | 30930219; |
Motif | |
Gene Encoded By | |
Mass | 5,486 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |