| IED ID | IndEnz0002015557 |
| Enzyme Type ID | protease015557 |
| Protein Name |
Insulin-2 Cleaved into: Insulin-2 B chain; Insulin-2 A chain |
| Gene Name | Ins2 Ins-2 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MALWIRFLPLLALLILWEPRPAQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVEDPQVAQLELGGGPGAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN |
| Enzyme Length | 110 |
| Uniprot Accession Number | P01323 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Disulfide bond (3); Peptide (2); Propeptide (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Cleavage on pair of basic residues;Direct protein sequencing;Disulfide bond;Glucose metabolism;Hormone;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000269|PubMed:4311938 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12475375; 17448147; 17993259; 18063688; 18165568; 20857410; 21773965; 21821716; 22068113; 22161251; 22990990; 23651473; 24440707; 26986474; 27336168; 28410130; 30790128; 32631952; 7822759; 9095092; |
| Motif | |
| Gene Encoded By | |
| Mass | 12,339 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |