| IED ID | IndEnz0002015567 |
| Enzyme Type ID | protease015567 |
| Protein Name |
mRNA interferase toxin HigB EC 3.1.-.- Endoribonuclease HigB Toxin HigB |
| Gene Name | higB ygjN b3083 JW3054 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKCYIREVMTHKEYDFFTAVHRTKGKK |
| Enzyme Length | 104 |
| Uniprot Accession Number | P64578 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.-.- |
| Enzyme Function | FUNCTION: Toxic component of a type II toxin-antitoxin (TA) system. A probable translation-dependent mRNA interferase. Overexpression causes cessation of cell growth and inhibits cell proliferation via inhibition of translation; this blockage is overcome by subsequent expression of antitoxin HigA. Overexpression causes cleavage of a number of mRNAs in a translation-dependent fashion, suggesting this is an mRNA interferase. {ECO:0000269|PubMed:19943910}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (1); Helix (5); Turn (2) |
| Keywords | 3D-structure;Endonuclease;Hydrolase;Nuclease;RNA-binding;Reference proteome;Stress response;Toxin-antitoxin system |
| Interact With | P67701 |
| Induction | INDUCTION: Induced by amino acid starvation and when translation is blocked. Induction is decreased in the absence of the Lon protease suggesting, by homology to other toxin-antitoxin systems, that Lon may degrade the HigA antitoxin. Transcription is negatively regulated by the cognate locus, probably by HigA. A member of the higB-higA operon. {ECO:0000269|PubMed:19943910}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 5IFG; 6KML; 6KMQ; |
| Mapped Pubmed ID | 16606699; 24561554; 27601326; 33000860; |
| Motif | |
| Gene Encoded By | |
| Mass | 12,103 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |