| IED ID | IndEnz0002015585 |
| Enzyme Type ID | protease015585 |
| Protein Name |
Minor histocompatibility antigen H13 EC 3.4.23.- Intramembrane protease 1 IMP-1 IMPAS-1 hIMP1 Presenilin-like protein 3 Signal peptide peptidase |
| Gene Name | HM13 H13 IMP1 PSL3 SPP MSTP086 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MDSALSDPHNGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSVRCARGKNASDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEANNFAMLGLGDVVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVTEMFSYEESNPKDPAAVTESKEGTEASASKGLEKKEK |
| Enzyme Length | 377 |
| Uniprot Accession Number | Q8TCT9 |
| Absorption | |
| Active Site | ACT_SITE 219; /evidence=ECO:0000250|UniProtKB:P49810; ACT_SITE 265; /evidence=ECO:0000250|UniProtKB:P49810 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.23.- |
| Enzyme Function | FUNCTION: Catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm. Required to generate lymphocyte cell surface (HLA-E) epitopes derived from MHC class I signal peptides (PubMed:11714810). May be necessary for the removal of the signal peptide that remains attached to the hepatitis C virus core protein after the initial proteolytic processing of the polyprotein (PubMed:12145199). Involved in the intramembrane cleavage of the integral membrane protein PSEN1 (PubMed:12077416, PubMed:11714810, PubMed:14741365). Cleaves the integral membrane protein XBP1 isoform 1 in a DERL1/RNF139-dependent manner (PubMed:25239945). May play a role in graft rejection (By similarity). {ECO:0000250|UniProtKB:Q9D8V0, ECO:0000269|PubMed:11714810, ECO:0000269|PubMed:12077416, ECO:0000269|PubMed:12145199, ECO:0000269|PubMed:14741365, ECO:0000269|PubMed:25239945}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Alternative sequence (3); Chain (1); Compositional bias (1); Frameshift (1); Glycosylation (2); Modified residue (1); Motif (1); Mutagenesis (6); Natural variant (1); Region (2); Sequence caution (1); Sequence conflict (6); Topological domain (10); Transmembrane (9) |
| Keywords | Alternative splicing;Cell membrane;Direct protein sequencing;Endoplasmic reticulum;Glycoprotein;Hydrolase;Membrane;Phosphoprotein;Protease;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | Q9BUN8; Q9BRK4; P07237; Q8WU17; P17861-1 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000269|PubMed:15998642}; Multi-pass membrane protein {ECO:0000305}. Membrane {ECO:0000269|PubMed:12077416, ECO:0000269|PubMed:15385547}; Multi-pass membrane protein {ECO:0000305}; Lumenal side {ECO:0000269|PubMed:12077416, ECO:0000269|PubMed:15385547}.; SUBCELLULAR LOCATION: [Isoform 4]: Cell membrane {ECO:0000250|UniProtKB:Q9D8V0}; Multi-pass membrane protein {ECO:0000250|UniProtKB:Q9D8V0}. |
| Modified Residue | MOD_RES 367; /note=Phosphoserine; /evidence=ECO:0007744|PubMed:24275569 |
| Post Translational Modification | PTM: N-glycosylated. {ECO:0000269|PubMed:12077416, ECO:0000269|PubMed:15385547, ECO:0000269|PubMed:19159218}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 14667819; 14704149; 14988012; 16738546; 16834339; 19942855; 20953506; 21636854; 21903422; 21911578; 22190034; 22593156; 24958774; 25416956; 26638075; 28198167; 28624439; 29155886; 29343547; 30348988; |
| Motif | MOTIF 317..319; /note=PAL |
| Gene Encoded By | |
| Mass | 41,488 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |