| IED ID | IndEnz0002015632 |
| Enzyme Type ID | protease015632 |
| Protein Name |
Metallocarboxypeptidase inhibitor b MCPI Cleaved into: Metallocarboxypeptidase inhibitor d Carboxypeptidase inhibitor d NvCId |
| Gene Name | |
| Organism | Nerita versicolor (Four-tooth nerite) (Sea snail) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Mollusca Gastropoda Neritimorpha Cycloneritida Neritoidea Neritidae Nerita Nerita versicolor (Four-tooth nerite) (Sea snail) |
| Enzyme Sequence | FHVPDDRPCIKPGRCPLVPDATCTFVCKAADNDFGYECQHVWTFEGQRVGCYA |
| Enzyme Length | 53 |
| Uniprot Accession Number | C0HJE8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Metallocarboxypeptidase inhibitor. Has an inhibitory effect on bovine CPA1 and porcine CPB1. Does not inhibit D.melanogaster svr (carboxypeptidase D). Shows no activity against serine proteases subtilisin or bovine trypsin, cysteine protease papain, and aspartyl protease porcine pepsin. {ECO:0000250|UniProtKB:P86912, ECO:0000269|Ref.1}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Disulfide bond (3); Metal binding (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Metal-binding;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,965 |
| Kinetics | |
| Metal Binding | METAL 53; /note=Zinc; via carboxylate; shared with metallocarboxypeptidase partner; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |