| IED ID | IndEnz0002015638 |
| Enzyme Type ID | protease015638 |
| Protein Name |
Mitochondrial inner membrane i-AAA protease supercomplex subunit MGR1 Mitochondrial genome-required protein 1 |
| Gene Name | MGR1 YCL044C YCL314 YCL44C |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Enzyme Sequence | MAVFTPPSGNSNSTDHTHTQDDHDKDDNDIKKFYIRPSLGLKLWGPLVPAPDNLPGLYTLITIQSAVGFFALWRLRRLYKLPPPRRIATGTHSDLSFGELPSEMIVNGKTKIKKDIADFPTLNRFSTTHGDIVLAPPPIIPRQSRFVSVRKLLWGLFGSLLLSQSLLELTRLNFLKYDPWCDEMKSVRDKKFFNNIVKYYHEGIDPTKIKVKDAMNGTPLSTNIPEVKQSVALARAQVEAQNPIIKWFGPLEYKPMSFNEYLNRMEFHLDMFEFFQNKRNIRENSIELINSISHNPQSSSTGLEGLSESKKLHLQNVEKRLHFLASSGDSISAPVKKRSSTTLSRGVILPHDTKGPQDIDLDTIRSLYDPWMTLALETSLSIKFIPTTMPSHTKTPTSTDQPLPGPTPKALTNEKTH |
| Enzyme Length | 417 |
| Uniprot Accession Number | P25573 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the mitochondrial inner membrane i-AAA protease supercomplex required for mitochondrial inner membrane protein turnover. Together with MGR3, functions in an adapter complex that targets substrates to the i-AAA protease for degradation. Required for growth of cells lacking the mitochondrial genome. {ECO:0000269|PubMed:16267274, ECO:0000269|PubMed:18843051}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (2); Region (2); Topological domain (3); Transmembrane (2) |
| Keywords | Membrane;Mitochondrion;Mitochondrion inner membrane;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | P32795 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:14576278, ECO:0000269|PubMed:16267274}; Multi-pass membrane protein {ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:14576278, ECO:0000269|PubMed:16267274}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11283351; 16554755; 17107617; 19536198; 20398622; 21300850; 22001671; 22498346; 23502676; 24374640; 24391512; 26751567; 29138251; |
| Motif | |
| Gene Encoded By | |
| Mass | 47,156 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |