| IED ID | IndEnz0002015650 |
| Enzyme Type ID | protease015650 |
| Protein Name |
Extracellular metalloprotease 1 EC 3.4.24.- |
| Gene Name | MEP1 CPC735_062670 |
| Organism | Coccidioides posadasii (strain C735) (Valley fever fungus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Onygenales Onygenales incertae sedis Coccidioides Coccidioides posadasii (Valley fever fungus) Coccidioides posadasii (strain C735) (Valley fever fungus) |
| Enzyme Sequence | MRVSVPVLALAFGSLAAAAPNAGRRTCGSVPPPEFFEASEKVAALEESGAFADLQAPIEVETYFHVVASSRSERDGYISDQMLSDQIRVMNEDYAPHGVHFNLRETTRTINPSWASDGNEIAMKRSLRKGGYAALNVYFLKDLGGALGYCYFPTNAAPGSTTFIRDGCSVLSSSVPGGSGAPYDLGKTATHEVGHWMGLFHTFQGGCSGQGDYVSDTPPQRSPSSGCPVGRDSCPGGGVDPIHNYMDYSVDSCMNQFTRGQGTRMSSMWRQFRAGK |
| Enzyme Length | 276 |
| Uniprot Accession Number | C5P3X6 |
| Absorption | |
| Active Site | ACT_SITE 192; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: Secreted metalloproteinase that allows assimilation of proteinaceous substrates. Pays a pivotal role as a pathogenicity determinant during infections and contributes to the ability of the pathogen to persist within the mammalian host. Digests an immunodominant cell surface antigen (SOWgp) and prevents host recognition of endospores during the phase of development when these fungal cells are most vulnerable to phagocytic cell defenses. {ECO:0000269|PubMed:16177346}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Compositional bias (1); Disulfide bond (1); Metal binding (2); Region (1); Signal peptide (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Hydrolase;Metal-binding;Metalloprotease;Protease;Secreted;Signal;Virulence;Zinc |
| Interact With | |
| Induction | INDUCTION: Peaks of expression occur during the endosporulation stage. {ECO:0000269|PubMed:16177346}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:16177346}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000269|PubMed:16177346 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 29,593 |
| Kinetics | |
| Metal Binding | METAL 191; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095; METAL 195; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095 |
| Rhea ID | |
| Cross Reference Brenda |