| IED ID | IndEnz0002015684 |
| Enzyme Type ID | protease015684 |
| Protein Name |
Cysteine proteinase 1 EC 3.4.22.- Amastigote cysteine proteinase A-1 |
| Gene Name | CYS1 |
| Organism | Leishmania pifanoi |
| Taxonomic Lineage | cellular organisms Eukaryota Discoba Euglenozoa Kinetoplastea (kinetoplasts) Metakinetoplastina Trypanosomatida Trypanosomatidae Leishmaniinae Leishmania Leishmania Leishmania mexicana species complex Leishmania pifanoi |
| Enzyme Sequence | MARRNPLLFAIVVTILFVVCYGSALIAQTPPPVDNFVASAHYGSFKKRHGKAFGGDAEEGHRFNAFKQNMQTAYFLNTQNPHAHYDVSGKFADLTPQEFAKLYLNPDYYARHLKDHKEDVHVDDSAPSGVMSVDWRDKGAVTPVKNQGLCGSCWAFSAIGNIEGQWAASGHSLVSLSEQMLVSCDNIDEGCNGGLMDQAMNWIMQSHNGSVFTEASYPYTSGGGTRPPCHDEGEVGAKITGFLSLPHDEERIAEWVEKRGPVAVAVDATTWQLYFGGVVSLCLAWSLNHGVLIVGFNKNAKPPYWIVKNSWGSSWGEKGYIRLAMGSNQCMLKNYPVSATVESPHTPHVPTTTA |
| Enzyme Length | 354 |
| Uniprot Accession Number | P35591 |
| Absorption | |
| Active Site | ACT_SITE 153; /evidence=ECO:0000250; ACT_SITE 289; /evidence=ECO:0000250; ACT_SITE 309; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: The cysteine proteinases have a potential role in host-parasite interaction and virulence. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (3); Glycosylation (1); Propeptide (1); Sequence conflict (3); Signal peptide (1) |
| Keywords | Disulfide bond;Glycoprotein;Hydrolase;Protease;Signal;Thiol protease;Virulence;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 38,746 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |