IED ID | IndEnz0002015691 |
Enzyme Type ID | protease015691 |
Protein Name |
Epidermal growth factor-binding protein type B EGF-BP B EC 3.4.21.119 Glandular kallikrein K13 mGK-13 Prorenin-converting enzyme 1 PRECE-1 Tissue kallikrein 13 |
Gene Name | Egfbp2 Egfbp-2 Klk-13 Klk13 |
Organism | Mus musculus (Mouse) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
Enzyme Sequence | MWFLILFLALSLGGIDAAPPLQSRVVGGFNCKKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSNDLMLLRLSKPADITDVVKPIALPTKEPKPGSKCLASGWGSITPTRWQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA |
Enzyme Length | 261 |
Uniprot Accession Number | P36368 |
Absorption | |
Active Site | ACT_SITE 65; /note=Charge relay system; ACT_SITE 120; /note=Charge relay system; ACT_SITE 213; /note=Charge relay system |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolyzes mouse Ren2 protein (a species of prorenin present in the submandibular gland) on the carboxy side of the arginine residue at the Lys-Arg-|- pair in the N-terminus, to yield mature renin.; EC=3.4.21.119; |
DNA Binding | |
EC Number | 3.4.21.119 |
Enzyme Function | FUNCTION: Cleaves REN2 at a dibasic site to yield mature renin. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (3); Beta strand (14); Chain (1); Disulfide bond (5); Domain (1); Glycosylation (1); Helix (4); Propeptide (1); Sequence conflict (1); Signal peptide (1) |
Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Glycoprotein;Hydrolase;Protease;Reference proteome;Serine protease;Signal;Zymogen |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..16; /evidence=ECO:0000269|PubMed:3036794 |
Structure 3D | X-ray crystallography (1) |
Cross Reference PDB | 1AO5; |
Mapped Pubmed ID | 15192120; 15203212; 15331780; 15545270; 1959648; 3007510; 6602295; 9507064; 9685728; |
Motif | |
Gene Encoded By | |
Mass | 28,689 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda | 3.4.21.119; |