| IED ID | IndEnz0002015721 |
| Enzyme Type ID | protease015721 |
| Protein Name |
Inducible metalloproteinase inhibitor protein Cleaved into: IMPI alpha |
| Gene Name | IMPI |
| Organism | Galleria mellonella (Greater wax moth) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Amphiesmenoptera Lepidoptera (butterflies and moths) Glossata Neolepidoptera Heteroneura Ditrysia Obtectomera Pyraloidea Pyralidae (snout moths) Galleriinae Galleria Galleria mellonella (Greater wax moth) |
| Enzyme Sequence | MKCLLYLCLWCYCVLVSSSIVLICNGGHEYYECGGACDNVCADLHIQNKTNCPIINIRCNDKCYCEDGYARDVNGKCIPIKDCPKIRSRRSIGIPVDKKCCTGPNEHYDEEKVSCPPETCISLVAKFSCIDSPPPSPGCSCNSGYLRLNLTSPCIPICDCPQMQHSPDCQ |
| Enzyme Length | 170 |
| Uniprot Accession Number | P82176 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits thermolysin, bacillolysin and pseudolysin, B.polymyxa metalloprotease and human MMP1 and MMP3. No activity on trypsin or cysteine protease papain. {ECO:0000269|PubMed:15115439, ECO:0000269|PubMed:9738891}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (2); Glycosylation (2); Helix (2); Signal peptide (1); Site (1); Turn (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Glycoprotein;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Reference proteome;Signal |
| Interact With | |
| Induction | INDUCTION: During humoral immune response (PubMed:9738891). By lipopolysaccharide (LPS) (PubMed:15115439). Induced by A.niger alpha-1,3-glucan (PubMed:34443685). {ECO:0000269|PubMed:15115439, ECO:0000269|PubMed:34443685, ECO:0000269|PubMed:9738891}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: Cleaved. {ECO:0000305}.; PTM: Five disulfide bonds are present. When artificially cleaved by thermolysin between Asn-56 and Ile-57, the two obtained chains (called heavy and light chains) remain linked.; PTM: The N-terminus is blocked. |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 3SSB; |
| Mapped Pubmed ID | 21915964; |
| Motif | |
| Gene Encoded By | |
| Mass | 18,759 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |