| IED ID | IndEnz0002015749 |
| Enzyme Type ID | protease015749 |
| Protein Name |
Kallikrein 1-related peptidase b27 EC 3.4.21.- Glandular kallikrein K27 mGK-27 Tissue kallikrein 27 mKlk27 |
| Gene Name | Klk1b27 Klk-27 Klk27 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MRFLILFLALSLGGIDAAPPVQSRIIGGFKCKKNSQPWHVAVLRSNKYICGGVLLDPNWVLTAAHCYGNDTSQHNVWLGKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDHIPHPEDKSNDLMLLRLSKPADITDAVKPIDLPTEEPKLGSTCLASGWGSITPTKYQIPNDLQCVFIKLLPNENCAKAYVHKVTDVMLCVGETGGGKGTCKGDSGGPLICDGVLHGITSWGSIPCAKPNAPGVFTKLIKFTSWIKDTMAKNP |
| Enzyme Length | 263 |
| Uniprot Accession Number | Q9JM71 |
| Absorption | |
| Active Site | ACT_SITE 65; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P36368; ACT_SITE 122; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P36368; ACT_SITE 215; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P36368 |
| Activity Regulation | ACTIVITY REGULATION: Strongly inhibited by protease inhibitors diisopropyl fluorophosphate, phenylmethanesulfonyl fluoride and SBTI. {ECO:0000269|PubMed:11082197}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Serine protease with chymotrypsin-like cleavage specificity. Shows activity towards casein, gelatin, IGFBP3 and fibronectin but not towards laminin or collagens I and IV. Does not hydrolyze kininogin to release Lys-bradykinin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (5); Domain (1); Glycosylation (2); Mutagenesis (1); Propeptide (1); Signal peptide (1) |
| Keywords | Disulfide bond;Glycoprotein;Hydrolase;Protease;Reference proteome;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..17; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10456837; 12437987; 15203212; 16800724; 23838579; 26624618; 6602295; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,742 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |