| IED ID | IndEnz0002015750 |
| Enzyme Type ID | protease015750 |
| Protein Name |
Kallikrein 1-related peptidase b16 EC 3.4.21.54 Gamma-renin, submandibular gland Glandular kallikrein K16 mGK-16 |
| Gene Name | Klk1b16 Klk-16 Klk16 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MWFLILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWQVAVYYHKEHICGGVLLDRNWVLTAAHCYVDECEVWLGKNQLFQEEPSAQNRLVSKSFPHPGFNMTLLTFEKLPPGADFSNDLMLLRLSKPADITDVVKPIDLPTKEPKLDSTCLVSGWGSITPTKWQKPDDLQCMFTKLLPNENCAKAYLLKVTDVMLCTIEMGEDKGPCVGDSGGPLICDGVLQGTVSIGPDPCGIPGVSAIYTNLVKFNSWIKDTMMKNA |
| Enzyme Length | 261 |
| Uniprot Accession Number | P04071 |
| Absorption | |
| Active Site | ACT_SITE 65; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 120; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 213; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of the Leu-|-Leu bond in synthetic tetradecapeptide renin substrate, to produce angiotensin I, but not active on natural angiotensinogen. Also hydrolyzes Bz-Arg-p-nitroanilide.; EC=3.4.21.54; |
| DNA Binding | |
| EC Number | 3.4.21.54 |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (5); Domain (1); Glycosylation (1); Propeptide (1); Sequence conflict (2); Signal peptide (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Glycoprotein;Hydrolase;Protease;Reference proteome;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000305 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12437987; 15203212; 16800724; 21267068; 21677750; 3007510; 6602295; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,722 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |