| IED ID | IndEnz0002015753 |
| Enzyme Type ID | protease015753 |
| Protein Name |
Kallikrein-1 EC 3.4.21.35 Gamma-NGF Nerve growth factor gamma chain PS kallikrein Pancreatic kallikrein RGK-1 rK-1 Tissue kallikrein True tissue kallikrein True kallikrein Cleaved into: Nerve growth factor gamma chain 1; Nerve growth factor gamma chain 2 |
| Gene Name | Ngfg Klk-1 Klk1 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MWFLILFLALSLGRNDAAPPVQSRVVGGYNCEMNSQPWQVAVYYFGEYLCGGVLIDPSWVITAAHCATDNYQVWLGRNNLYEDEPFAQHRLVSQSFPHPGFNQDLIWNHTRQPGDDYSNDLMLLHLSQPADITDGVKVIDLPIEEPKVGSTCLASGWGSITPDGLELSDDLQCVNIDLLSNEKCVEAHKEEVTDLMLCAGEMDGGKDTCKGDSGGPLICNGVLQGITSWGFNPCGEPKKPGIYTKLIKFTPWIKEVMKENP |
| Enzyme Length | 261 |
| Uniprot Accession Number | P00758 |
| Absorption | |
| Active Site | ACT_SITE 65; /note=Charge relay system; ACT_SITE 120; /note=Charge relay system; ACT_SITE 213; /note=Charge relay system |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage of Arg-|-Xaa bonds in small molecule substrates. Highly selective action to release kallidin (lysyl-bradykinin) from kininogen involves hydrolysis of Met-|-Xaa or Leu-|-Xaa.; EC=3.4.21.35; |
| DNA Binding | |
| EC Number | 3.4.21.35 |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (3); Disulfide bond (5); Domain (1); Erroneous initiation (3); Glycosylation (1); Propeptide (1); Signal peptide (1) |
| Keywords | Disulfide bond;Glycoprotein;Hydrolase;Protease;Reference proteome;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000305 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 15809361; 25623731; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,852 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.35; |