| IED ID | IndEnz0002015755 |
| Enzyme Type ID | protease015755 |
| Protein Name |
Blarinasin-1 EC 3.4.21.- Kallikrein-1 Fragment |
| Gene Name | KLK1 |
| Organism | Blarina brevicauda (Northern short-tailed shrew) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Eulipotyphla (hedgehogs shrews moles and others) Soricidae (shrews) Soricinae (red-toothed shrews) Blarina Blarina brevicauda (Northern short-tailed shrew) |
| Enzyme Sequence | YLLLLCLPLTLMGTGAVPPGPSIEIHPRIVGGWECDKHSQPWQALLTFTNGLDGVCGGVLVHPQWVLTAAHCIGDNYKIKLGLHDRFSKDDPFQEFQVSASFPHPSYNMRLLKLLLSDELNDTYYDEISLGADFSHDLMMMQLEKPVQLNDAVQVLDLPTQEPQVGSKCHASGWGSMDPYSRNFPRTGKLQCVDLTLMSNNECSRSHIFKITDDMLCAGHIKGRKDTCGGDSGGPLICDGVFQGTTSWGSYPCGKPRTPGVYVKIFSHVDWIREIIATHS |
| Enzyme Length | 280 |
| Uniprot Accession Number | Q5FBW2 |
| Absorption | |
| Active Site | ACT_SITE 71; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 137; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 232; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | ACTIVITY REGULATION: Strongly inhibited by aprotinin, moderately inhibited by secretory leukoprotease inhibitor (SLPI), leupeptin, benzamidine, and phenylmethanesulfonyl fluoride (PMSF), weakly inhibited by urinary trypsin inhibitor, and Kunitz-type soybean trypsin inhibitor and not inhibited by EDTA and alpha-1 protease inhibitor. {ECO:0000269|PubMed:15843162}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: A kallikrein-like protease. It preferentially converts human high-molecular-weight kininogen (HK) to bradykinin. Displays broad substrate specificity in vitro, with highest activity toward Boc-Val-Leu-Lys-MCA, Boc-Glu-Lys-Lys-MCA, Boc-Glu(OBzl)-Ala-Arg-MCA, Boc-Val-Pro-Arg-MCA, ZPhe-Arg-MCA and Pro-Phe-Arg-MCA. Has preference for Arg and Lys in position P1 and hydrophobic residues in position P2. Is not toxic to mice. {ECO:0000269|PubMed:15843162}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 8.5. {ECO:0000269|PubMed:15843162}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (5); Domain (1); Glycosylation (2); Non-terminal residue (1); Propeptide (1); Signal peptide (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Glycoprotein;Hydrolase;Protease;Secreted;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:15843162}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL <1..16; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 30,963 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |