IED ID | IndEnz0002015779 |
Enzyme Type ID | protease015779 |
Protein Name |
Neutrophil gelatinase-associated lipocalin NGAL Alpha-2-microglobulin-related protein Alpha-2U globulin-related protein Lipocalin 24p3 Lipocalin-2 Siderocalin LCN2 p25 |
Gene Name | Lcn2 |
Organism | Rattus norvegicus (Rat) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
Enzyme Sequence | MGLGVLCLALVLLGVLQSQAQDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAGNAVQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN |
Enzyme Length | 198 |
Uniprot Accession Number | P30152 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | BINDING 126; /note=Enterobactin; /evidence=ECO:0000250|UniProtKB:P80188; BINDING 145; /note=Carboxymycobactin; /evidence=ECO:0000250|UniProtKB:P80188; BINDING 154; /note=Carboxymycobactin; /evidence=ECO:0000250|UniProtKB:P80188; BINDING 154; /note=Enterobactin; /evidence=ECO:0000250|UniProtKB:P80188; BINDING 158; /note=Carboxymycobactin; /evidence=ECO:0000250|UniProtKB:P80188 |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development (By similarity). Binds iron through association with 2,3-dihydroxybenzoic acid (2,3-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis (By similarity). Involved in innate immunity; limits bacterial proliferation by sequestering iron bound to microbial siderophores, such as enterobactin. Can also bind siderophores from M.tuberculosis (By similarity). {ECO:0000250|UniProtKB:P11672, ECO:0000250|UniProtKB:P80188}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Beta strand (11); Binding site (5); Chain (1); Disulfide bond (1); Glycosylation (1); Helix (5); Modified residue (1); Region (1); Sequence conflict (2); Signal peptide (1) |
Keywords | 3D-structure;Apoptosis;Cytoplasmic vesicle;Disulfide bond;Glycoprotein;Immunity;Innate immunity;Ion transport;Iron;Iron transport;Pyrrolidone carboxylic acid;Reference proteome;Secreted;Signal;Transport |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P80188}. Cytoplasmic granule lumen {ECO:0000250|UniProtKB:P80188}. Cytoplasmic vesicle lumen {ECO:0000250|UniProtKB:P80188}. Note=Upon binding to the SLC22A17 (24p3R) receptor, it is internalized (By similarity). Releases the bound iron in the acidic lumen of cytoplasmic vesicles (By similarity). {ECO:0000250|UniProtKB:P11672, ECO:0000250|UniProtKB:P80188}. |
Modified Residue | MOD_RES 21; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000250|UniProtKB:P80188 |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000250 |
Structure 3D | NMR spectroscopy (1) |
Cross Reference PDB | 2K23; |
Mapped Pubmed ID | 15623795; 17148685; 17356516; 17553663; 18292240; 18308701; 19129400; 19221211; 19303090; 19329498; 19860839; 20043115; 20057160; 22249220; 22366155; 22997966; 23085980; 23331620; 23335628; 23364806; 23416150; 23431168; 23683031; 24587658; 24853299; 24916903; 24939880; 25076856; 25412834; 25557118; 26004810; 26013918; 27592368; 29122651; 29590655; 30574656; 31539545; 32174475; 32627017; |
Motif | |
Gene Encoded By | |
Mass | 22,476 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |