Detail Information for IndEnz0002015820
IED ID IndEnz0002015820
Enzyme Type ID protease015820
Protein Name Beta-nerve growth factor
Beta-NGF
Gene Name NGF NGFB
Organism Bos taurus (Bovine)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos (oxen cattle) Bos taurus (Bovine)
Enzyme Sequence MSMLFYTLITALLIGIQAAPHTESNVPAGHAIPQAHWIKLQHSLDTVLRRAHSAPAGPIAARVAGQTHNITVDPKLFKKRRLRSPRVLFSTQPPPVAADTQDLDFEAGGASSFNRTHRSKRSSSHPVFHRGEFSVCDSISVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDAKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKTGQRA
Enzyme Length 241
Uniprot Accession Number P13600
Absorption
Active Site
Activity Regulation
Binding Site BINDING 173; /note=a 1-acyl-sn-glycero-3-phospho-(1D-myo-inositol); via amide nitrogen and carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:P01139; BINDING 209; /note=a 1-acyl-sn-glycero-3-phospho-(1D-myo-inositol); shared with dimeric partner; /evidence=ECO:0000250|UniProtKB:P01139; BINDING 209; /note=a 1-acyl-sn-glycero-3-phospho-L-serine; shared with dimeric partner; /evidence=ECO:0000250|UniProtKB:P01139
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades to regulate neuronal proliferation, differentiation and survival (By similarity). The immature NGF precursor (proNGF) functions as ligand for the heterodimeric receptor formed by SORCS2 and NGFR, and activates cellular signaling cascades that lead to inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton and neuronal growth cone collapse. In contrast to mature NGF, the precursor form (proNGF) promotes neuronal apoptosis (in vitro) (By similarity). Inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI (By similarity). Binds lysophosphatidylinositol and lysophosphatidylserine between the two chains of the homodimer. The lipid-bound form promotes histamine relase from mast cells, contrary to the lipid-free form (By similarity). {ECO:0000250|UniProtKB:P01138, ECO:0000250|UniProtKB:P01139}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Binding site (3); Chain (1); Disulfide bond (3); Glycosylation (1); Propeptide (1); Sequence conflict (4); Signal peptide (1)
Keywords Cleavage on pair of basic residues;Disulfide bond;Endosome;Glycoprotein;Growth factor;Lipid-binding;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Reference proteome;Secreted;Signal
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P01138}. Endosome lumen {ECO:0000250|UniProtKB:P01139}. Note=ProNGF is endocytosed after binding to the cell surface receptor formed by SORT1 and NGFR. {ECO:0000250|UniProtKB:P01139}.
Modified Residue
Post Translational Modification
Signal Peptide SIGNAL 1..18; /evidence=ECO:0000255
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 26,669
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda