IED ID | IndEnz0002015824 |
Enzyme Type ID | protease015824 |
Protein Name |
Beta-nerve growth factor Beta-NGF |
Gene Name | NGF NGFB |
Organism | Mastomys natalensis (African soft-furred rat) (Praomys natalensis) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mastomys (multimammate rats) Mastomys natalensis (African soft-furred rat) (Praomys natalensis) |
Enzyme Sequence | MSMLFYTLITALLIGVQAEPYTDSNLPEGDSVPEAHWTKLQHSLDTALRRARSAPAAPIAARVTGQTRNITVDPRLFKKRKLRSPRVLFSTQPPPTSSDTLDLDFQAHGTISFNRTHRSKRSSTHPVFQMGEFSVCDSVSVWVGDKTTATDIKGNEVTVLGEVNINNSVFKQYFFETKCRARNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDRQAAWRFIRIDTACVCVLTRKAPRRG |
Enzyme Length | 241 |
Uniprot Accession Number | P20675 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI. {ECO:0000250|UniProtKB:P01138}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Disulfide bond (3); Erroneous initiation (1); Glycosylation (3); Propeptide (1); Signal peptide (1) |
Keywords | Cleavage on pair of basic residues;Disulfide bond;Glycoprotein;Growth factor;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Secreted;Signal |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 27,036 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |