| IED ID | IndEnz0002015827 |
| Enzyme Type ID | protease015827 |
| Protein Name |
Aspartic proteinase nepenthesin-1 EC 3.4.23.12 Nepenthesin-I Fragments |
| Gene Name | |
| Organism | Nepenthes distillatoria (Pitcher plant) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae Caryophyllales Nepenthaceae Nepenthes Nepenthes distillatoria (Pitcher plant) |
| Enzyme Sequence | IGPSGVETTVYAGDGEYLMXLSIGTPAQPFSAIMDTGSDLIWTQXQPXTQXFXQSDPQGSSSFSTLPCGYGDSETQGSMGTETFTFGSVSIPNITFGXGEGPLPLPXQLDVAKYITLDLPIDPSAFDLCFQTPSDPSNLQIPTFVMHFDTGNSVVSFVSAQCGA |
| Enzyme Length | 164 |
| Uniprot Accession Number | P69476 |
| Absorption | |
| Active Site | ACT_SITE 35; /evidence=ECO:0000255|PROSITE-ProRule:PRU10094 |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by pepstatin and by diazoacetyl-D,L-norleucine methyl ester (DAN) in the presence of Cu(2+) ions. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Similar to pepsin, but also cleaves on either side of Asp and at Lys-|-Arg.; EC=3.4.23.12; |
| DNA Binding | |
| EC Number | 3.4.23.12 |
| Enzyme Function | FUNCTION: Extracellular proteinase found in the pitcher fluid of carnivorous plants. Digest prey for nitrogen uptake. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 55 degrees Celsius. Thermostable up to 50 degrees Celsius. Retains 60% of the original activity after incubation for 30 days at 50 degrees Celsius.; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 2.6. Retains 95% and 79% of the original activity after incubation for 30 days at pH 3.0 and pH 10.0 respectively.; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Glycosylation (1); Natural variant (1); Non-adjacent residues (7); Non-terminal residue (1); Region (1) |
| Keywords | Aspartyl protease;Direct protein sequencing;Glycoprotein;Hydrolase;Protease;Secreted;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:15035659}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 17,271 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |