IED ID | IndEnz0002015904 |
Enzyme Type ID | protease015904 |
Protein Name |
Late L2 mu core protein Protein X pX pMu |
Gene Name | PX |
Organism | Canine adenovirus serotype 1 (strain RI261) (CAdV-1) (Canine adenovirus 1 (strain RI261)) |
Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Preplasmiviricota Tectiliviricetes Rowavirales Adenoviridae Mastadenovirus Canine mastadenovirus A Canine adenovirus 1 Canine adenovirus serotype 1 (strain RI261) (CAdV-1) (Canine adenovirus 1 (strain RI261)) |
Enzyme Sequence | MAGRNVTLRLRVPVRTKITGAGRRRGRRTRIRCGRMKGGFLPALIPLIAAAIGAVPGIASVALQAARH |
Enzyme Length | 68 |
Uniprot Accession Number | P68975 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: The role of the precursor might be to condense the viral prochromatin for encapsidation by virtue of the two basic domains. {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Peptide (1); Propeptide (2); Site (2) |
Keywords | DNA-binding;Late protein;Virion |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Virion {ECO:0000305}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 7,226 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |