| IED ID | IndEnz0002015957 |
| Enzyme Type ID | protease015957 |
| Protein Name |
Mambaquaretin-1 MQ-1 |
| Gene Name | |
| Organism | Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Elapidae Elapinae Dendroaspis Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps) |
| Enzyme Sequence | RPSFCNLPVKPGPCNGFFSAFYYSQKTNKCHSFTYGGCKGNANRFSTIEKCRRTCVG |
| Enzyme Length | 57 |
| Uniprot Accession Number | A0A1Z0YU59 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Interacts with vasopressin V2 receptor (V2R/AVPR2) and fully inhibits three major signaling pathways of this receptor. Shows weak inhibition on trypsin (PRSS1) (IC(50)=14.8 uM) and Kv1.1/KCNA1 (IC(50)=8.2 uM). In vivo, this protein shows an aquaretic effect. Urine output increases and urine osmolality decreases dramatically under treatment with this protein, without differences observed between healthy and pcy mice (murine model of the autosomal-dominant polycystic kidney disease (ADPKD)). This protein does not modify protein, electrolyte and urea excretions in the urine samples, but produces a 3-fold decrease of creatinine levels. Intraperitoneal injection of this protein into the pcy mice significantly reduces the number of renal cysts and the total area of cysts. {ECO:0000269|PubMed:28630289}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Disulfide bond (3); Helix (2); Mutagenesis (3); Region (1); Turn (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;G-protein coupled receptor impairing toxin;Ion channel impairing toxin;Pharmaceutical;Potassium channel impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Toxin;Voltage-gated potassium channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:28630289}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 5M4V; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,377 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |