| IED ID |
IndEnz0002015958 |
| Enzyme Type ID |
protease015958 |
| Protein Name |
Magnetosome protein MamF
|
| Gene Name |
mamF amb0953 |
| Organism |
Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Alphaproteobacteria
Rhodospirillales
Rhodospirillaceae (purple nonsulfur bacteria)
Magnetospirillum
Magnetospirillum magneticum
Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
|
| Enzyme Sequence |
MAEAILLETENTPCGCRSYLMAGLSYLGILCFVPLLMSRDDEYVYFHAKQGLVLWMWSVLAMFALHLPLIGKWLFGFSSMGVLVLSVAGLASVALRRTWRLPLVGYFVALI |
| Enzyme Length |
111 |
| Uniprot Accession Number |
Q2W8R8 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Plays a role in regulating magnetite crystal size; partially redundant function with MmsF. {ECO:0000250|UniProtKB:Q6NE74}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Topological domain (4); Transmembrane (3) |
| Keywords |
Biomineralization;Magnetosome;Membrane;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Magnetosome membrane {ECO:0000269|PubMed:21414040}; Multi-pass membrane protein {ECO:0000255}. Note=Tagged protein forms straight lines extending along most of the cell associated with its inner curvature, in the correct position to be filaments that are seen associated with magnetosomes. In a mamE disruption MamF mislocalizes as a linear punctate pattern. {ECO:0000269|PubMed:21414040}. |
| Modified Residue |
|
| Post Translational Modification |
PTM: Probably subject to cleavage or degradation. {ECO:0000250|UniProtKB:Q6NE74}. |
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
12,405 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|