| IED ID |
IndEnz0002015960 |
| Enzyme Type ID |
protease015960 |
| Protein Name |
Nucleoid-associated protein Lsr2
|
| Gene Name |
lsr2 MT3704 |
| Organism |
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Actinobacteria
Actinomycetia (high G+C Gram-positive bacteria)
Corynebacteriales
Mycobacteriaceae
Mycobacterium
Mycobacterium tuberculosis complex
Mycobacterium tuberculosis
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
|
| Enzyme Sequence |
MAKKVTVTLVDDFDGSGAADETVEFGLDGVTYEIDLSTKNATKLRGDLKQWVAAGRRVGGRRRGRSGSGRGRGAIDREQSAAIREWARRNGHNVSTRGRIPADVIDAYHAAT |
| Enzyme Length |
112 |
| Uniprot Accession Number |
P9WIP6 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
DNA_BIND 97..102; /evidence=ECO:0000250|UniProtKB:P9WIP7 |
| EC Number |
|
| Enzyme Function |
FUNCTION: DNA-bridging protein that has both architectural and regulatory roles. Influences the organization of chromatin and gene expression by binding non-specifically to DNA, with a preference for AT-rich sequences, and bridging distant DNA segments. Represses expression of multiple genes involved in a broad range of cellular processes. May coordinate global gene regulation and virulence as well as genes important for adaptation to changing O(2) levels. Protects against reactive oxygen intermediates (By similarity). {ECO:0000250|UniProtKB:P9WIP7}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); DNA binding (1); Region (1) |
| Keywords |
Cytoplasm;DNA-binding;Repressor;Transcription;Transcription regulation;Virulence |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Cytoplasm, nucleoid {ECO:0000250|UniProtKB:P9WIP7}. |
| Modified Residue |
|
| Post Translational Modification |
PTM: The three N-terminal residues may be cleaved by proteases in response to external stress. This cleavage may be required for oligomerization, which leads to chromosome compaction and protection (By similarity). {ECO:0000250|UniProtKB:P9WIP7}. |
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
12,098 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|