| IED ID | IndEnz0002016005 |
| Enzyme Type ID | protease016005 |
| Protein Name |
GPI-anchor transamidase GPI transamidase EC 3.-.-.- GPI8 homolog hGPI8 Phosphatidylinositol-glycan biosynthesis class K protein PIG-K |
| Gene Name | PIGK GPI8 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDDVEVDYRSYEVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLPVAQIIHQKPKLKDWHPPGGFILGLWALIIMVFFKTYGIKHMKFIF |
| Enzyme Length | 395 |
| Uniprot Accession Number | Q92643 |
| Absorption | |
| Active Site | ACT_SITE 164; /evidence=ECO:0000269|PubMed:10793132; ACT_SITE 206; /evidence=ECO:0000269|PubMed:10793132 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.-.-.- |
| Enzyme Function | FUNCTION: Mediates GPI anchoring in the endoplasmic reticulum, by replacing a protein's C-terminal GPI attachment signal peptide with a pre-assembled GPI. During this transamidation reaction, the GPI transamidase forms a carbonyl intermediate with the substrate protein. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis. |
| nucleotide Binding | |
| Features | Active site (2); Alternative sequence (1); Chain (1); Disulfide bond (1); Mutagenesis (5); Natural variant (10); Region (1); Sequence conflict (1); Signal peptide (1); Topological domain (2); Transmembrane (1) |
| Keywords | Alternative splicing;Direct protein sequencing;Disease variant;Disulfide bond;Endoplasmic reticulum;Epilepsy;GPI-anchor biosynthesis;Hydrolase;Membrane;Mental retardation;Protease;Reference proteome;Signal;Thiol protease;Transmembrane;Transmembrane helix |
| Interact With | O43292; Q969N2 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000269|PubMed:11483512}; Single-pass type I membrane protein {ECO:0000269|PubMed:11483512}. |
| Modified Residue | |
| Post Translational Modification | PTM: The disulfide bond between PIGK/GPI8 and PIGT is important for normal enzyme activity. |
| Signal Peptide | SIGNAL 1..27; /evidence="ECO:0000269|PubMed:11483512, ECO:0007744|PubMed:25944712" |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12616539; 12802054; 22824918; 24189400; 26496610; 26638075; 27919619; 33392778; 33496978; 34193731; 34576938; |
| Motif | |
| Gene Encoded By | |
| Mass | 45,252 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |