| IED ID | IndEnz0002016013 |
| Enzyme Type ID | protease016013 |
| Protein Name |
Adenosine 5'-monophosphoramidase HINT1 EC 3.9.1.- Desumoylating isopeptidase HINT1 EC 3.4.22.- Histidine triad nucleotide-binding protein 1 |
| Gene Name | HINT1 |
| Organism | Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Ponginae Pongo Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii) |
| Enzyme Sequence | MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDNESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG |
| Enzyme Length | 126 |
| Uniprot Accession Number | Q5RF69 |
| Absorption | |
| Active Site | ACT_SITE 112; /note=Tele-AMP-histidine intermediate; /evidence=ECO:0000250|UniProtKB:P49773 |
| Activity Regulation | |
| Binding Site | BINDING 99; /note=AMP; /evidence=ECO:0000250|UniProtKB:P49773 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=adenosine 5'-phosphoramidate + H2O = AMP + NH4(+); Xref=Rhea:RHEA:67916, ChEBI:CHEBI:15377, ChEBI:CHEBI:28938, ChEBI:CHEBI:57890, ChEBI:CHEBI:456215; Evidence={ECO:0000250|UniProtKB:P49773}; |
| DNA Binding | |
| EC Number | 3.9.1.-; 3.4.22.- |
| Enzyme Function | FUNCTION: Exhibits adenosine 5'-monophosphoramidase activity, hydrolyzing purine nucleotide phosphoramidates with a single phosphate group such as adenosine 5'monophosphoramidate (AMP-NH2) to yield AMP and NH2 (By similarity). Hydrolyzes adenosine 5'monophosphomorpholidate (AMP-morpholidate) and guanosine 5'monophosphomorpholidate (GMP-morpholidate) (By similarity). Hydrolyzes lysyl-AMP (AMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) generated by lysine tRNA ligase, as well as Met-AMP, His-AMP and Asp-AMP, lysyl-GMP (GMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) and AMP-N-alanine methyl ester (By similarity). Can also convert adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates with concomitant release of hydrogen sulfide (By similarity). In addition, functions as scaffolding protein that modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex and by the complex formed with MITF and CTNNB1 (By similarity). Modulates p53/TP53 levels and p53/TP53-mediated apoptosis. Modulates proteasomal degradation of target proteins by the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex (By similarity). Also exhibits SUMO-specific isopeptidase activity, deconjugating SUMO1 from RANGAP1 and RGS17 (By similarity). {ECO:0000250|UniProtKB:P49773, ECO:0000250|UniProtKB:P70349}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | NP_BIND 43..44; /note=AMP; /evidence=ECO:0000250|UniProtKB:P49773; NP_BIND 105..107; /note=AMP; /evidence=ECO:0000250|UniProtKB:P49773; NP_BIND 112..114; /note=AMP; /evidence=ECO:0000250|UniProtKB:P49773 |
| Features | Active site (1); Binding site (1); Chain (1); Domain (1); Initiator methionine (1); Modified residue (5); Motif (1); Nucleotide binding (3) |
| Keywords | Acetylation;Apoptosis;Cytoplasm;Hydrolase;Nucleotide-binding;Nucleus;Phosphoprotein;Protease;Reference proteome;Thiol protease;Transcription;Transcription regulation;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:P49773}. Nucleus {ECO:0000250|UniProtKB:P49773}. |
| Modified Residue | MOD_RES 2; /note=N-acetylalanine; /evidence=ECO:0000250|UniProtKB:P62958; MOD_RES 21; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:P49773; MOD_RES 30; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:P49773; MOD_RES 45; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P70349; MOD_RES 72; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P70349 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 110..114; /note=Histidine triad motif |
| Gene Encoded By | |
| Mass | 13,801 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:67916 |
| Cross Reference Brenda |