| IED ID | IndEnz0002016020 |
| Enzyme Type ID | protease016020 |
| Protein Name |
DNA-binding transcriptional activator HetR EC 3.4.21.- Heterocyst differentiation control protein |
| Gene Name | hetR Npun_R1722 |
| Organism | Nostoc punctiforme (strain ATCC 29133 / PCC 73102) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Cyanobacteria/Melainabacteria group Cyanobacteria Nostocales Nostocaceae Nostoc Nostoc punctiforme Nostoc punctiforme (strain ATCC 29133 / PCC 73102) |
| Enzyme Sequence | MSNDIDLIKRLDPSAMDQIMLYLAFSAMRTSGHRHGAFLDAAATAAKCAIYMTYLEQGQNLRMTGHLHHLEPKRVKIIVEEVRQALTEGKLLKMLGSQEPRYLIQLPYVWLEKYPWQPGRSRVPGTSLTSEEKRQIEQKLPSNLPDAQLVSSFEFLDLIEFLHRRSQEDLPTEHQMPLSEALGEHIKRRLLYSGTVTRIDSPWGMPFYALTRPFYAPADDQERTYIMVEDTARYFRMMKNWAERRRNAMRLLEELDILPEKMEQAMEELDEIIRAWADKYHQDGGIAVVLQTVFGEKED |
| Enzyme Length | 299 |
| Uniprot Accession Number | Q9AH77 |
| Absorption | |
| Active Site | ACT_SITE 152; /evidence=ECO:0000255|HAMAP-Rule:MF_00781 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Controls heterocyst differentiation. Dimerization is required for DNA-binding. Has both a protease and a DNA-binding activity (By similarity). Increased expression leads to more heterocysts than usual (PubMed:11274126). {ECO:0000255|HAMAP-Rule:MF_00781, ECO:0000269|PubMed:11274126}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (1) |
| Keywords | Activator;DNA-binding;Disulfide bond;Heterocyst;Hydrolase;Protease;Reference proteome;Serine protease;Transcription;Transcription regulation |
| Interact With | |
| Induction | INDUCTION: By nitrogen deficiency. Transcription increases 3-6 hours after nitrogen reduction, peaks at 12 hours and declines slowly after. Under control of both nctA and hetF. {ECO:0000269|PubMed:11274126}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 34,843 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |