| IED ID |
IndEnz0002016101 |
| Enzyme Type ID |
protease016101 |
| Protein Name |
Adapter protein MecA 2
|
| Gene Name |
mecA2 BC_1490 |
| Organism |
Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus cereus group
Bacillus cereus
Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
|
| Enzyme Sequence |
MRLERLNYNKIKIFLTFDDLSERGLTKEDLWRNAPKVQQLFRDMMQEANKELGFEADGPIAVEVFSLQAQGMVVIVTKENQEMDTDDEFRDEFIEMQVTLDESEHILYEFATLDDVINLSNRLYNLGVTGGKLYTWDERFYLWVEEEEQIQLLKADFIAILAEYGNPSTATIYRIMEYGKELMDVNAIEQIHNYFVKKQNLS |
| Enzyme Length |
202 |
| Uniprot Accession Number |
Q81FS9 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis. Acts negatively in the development of competence by binding ComK and recruiting it to the ClpCP protease. When overexpressed, inhibits sporulation. Also involved in Spx degradation by ClpC (By similarity). {ECO:0000250}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1) |
| Keywords |
Competence;Reference proteome;Sporulation |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
23,791 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|