IED ID | IndEnz0002016105 |
Enzyme Type ID | protease016105 |
Protein Name |
Extracellular metalloprotease AFUA_1G07730 EC 3.4.24.- |
Gene Name | AFUA_1G07730 |
Organism | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Fumigati Neosartorya fumigata (Aspergillus fumigatus) Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
Enzyme Sequence | MLPFNSCVYVLLIISLMSNCRALCRATALQGRSLCATGGPDAAFRAEHERLSAFESRPSSGSYDMRRALEPIEIETWFHIVSGETDADLVTDEMVILQLHYLQKAYEKASISYRLKGVTRHINETWARNGDDSAMKKALRRGGYSTLNVYFQTNLQPPSTTDFARWTSDGDNRHAYNSDLAPLSVLGFCTLPDPSINSSSPRSSYSKDGCNVLAKTMPGGPMTHYNRGGTAIHEIGHWNGLLHTFEGESCSEDNAGDYIADTPQQSVPTDGCPSQKDSCPDSPGLDDIHNFMDYSSDDCYASFTSNQLKRMRDMWFSMRKGK |
Enzyme Length | 322 |
Uniprot Accession Number | Q4WJ01 |
Absorption | |
Active Site | ACT_SITE 234; /evidence=ECO:0000250 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.4.24.- |
Enzyme Function | FUNCTION: Secreted metalloproteinase that allows assimilation of proteinaceous substrates. Plays a pivotal role as a pathogenicity determinant during infections and contributes to the ability of the pathogen to persist within the mammalian host (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (1); Chain (1); Disulfide bond (1); Erroneous initiation (1); Glycosylation (2); Metal binding (2); Signal peptide (1) |
Keywords | Disulfide bond;Glycoprotein;Hydrolase;Metal-binding;Metalloprotease;Protease;Reference proteome;Secreted;Signal;Virulence;Zinc |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 35,778 |
Kinetics | |
Metal Binding | METAL 233; /note=Zinc; catalytic; /evidence=ECO:0000250; METAL 237; /note=Zinc; catalytic; /evidence=ECO:0000250 |
Rhea ID | |
Cross Reference Brenda |