| IED ID | IndEnz0002016116 |
| Enzyme Type ID | protease016116 |
| Protein Name |
Cytochrome c oxidase subunit 5A, mitochondrial Cytochrome c oxidase polypeptide Va |
| Gene Name | COX5A YNL052W N2474 YNL2474W |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Enzyme Sequence | MLRNTFTRAGGLSRITSVRFAQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK |
| Enzyme Length | 153 |
| Uniprot Accession Number | P00424 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of COX2 and heme A of COX1 to the active site in COX1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix. {ECO:0000305|PubMed:30598554}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Energy metabolism; oxidative phosphorylation. |
| nucleotide Binding | |
| Features | Beta strand (2); Chain (1); Helix (9); Sequence conflict (1); Topological domain (2); Transit peptide (1); Transmembrane (1); Turn (2) |
| Keywords | 3D-structure;Direct protein sequencing;Membrane;Mitochondrion;Mitochondrion inner membrane;Oxidoreductase;Reference proteome;Transit peptide;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | INDUCTION: By oxygen at the level of transcription through heme (PubMed:2546055). Expression drops rapidly when the oxygen concentration falls below 0.5 uM O(2) (PubMed:9169434). {ECO:0000269|PubMed:2546055, ECO:0000269|PubMed:9169434}. |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000269|PubMed:30598554}; Single-pass membrane protein {ECO:0000269|PubMed:30598554}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | Electron microscopy (4) |
| Cross Reference PDB | 6GIQ; 6HU9; 6YMX; 6YMY; |
| Mapped Pubmed ID | 10385027; 10849661; 11135551; 11214302; 11245784; 11805826; 11943460; 12034475; 15807653; 15905047; 15960801; 16199211; 163234; 163235; 16429126; 16554755; 1665335; 16760263; 17215873; 17445721; 17453165; 17721079; 17882259; 18045776; 18388202; 18445471; 18465791; 1847916; 1847927; 18522805; 18779372; 18839289; 19168025; 19536198; 1967076; 19855843; 20111601; 20136511; 20398622; 20398659; 20535573; 210176; 21326212; 21471218; 21541367; 21549177; 21610197; 21925484; 21958598; 22011573; 221509; 221510; 22904327; 22927468; 23172229; 23212899; 23266989; 23276920; 23467670; 23537388; 23897805; 24158904; 24220496; 24530295; 25002117; 25241981; 2557058; 25880855; 26035862; 26608359; 27662906; 27693354; 2824990; 33016568; 43469; 6267074; 6330135; 7814361; 7876120; 8757790; 8811190; 9848233; |
| Motif | |
| Gene Encoded By | |
| Mass | 17,140 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |