| IED ID |
IndEnz0002016140 |
| Enzyme Type ID |
protease016140 |
| Protein Name |
Fusion protein P6
|
| Gene Name |
P6 |
| Organism |
Pseudomonas phage phi6 (Bacteriophage phi-6) |
| Taxonomic Lineage |
Viruses
Riboviria
Orthornavirae
Duplornaviricota
Vidaverviricetes
Mindivirales
Cystoviridae
Cystovirus
Pseudomonas phage phi6 (Bacteriophage phi-6)
|
| Enzyme Sequence |
MSIFSSLFKVIKKVISKVVATLKKIFKKIWPLLLIVAIIYFAPYLAGFFTSAGFTGIGGIFSSIATTITPTLTSFLSTAWSGVGSLASTAWSGFQSLGMGTQLAVVSGAAALIAPEETAQLVTEIGTTVGDIAGTIIGGVAKALPGWIWIAAGGLAVWALWPSSDSKE |
| Enzyme Length |
168 |
| Uniprot Accession Number |
P11128 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Mediates the fusion with the host outer membrane during virus entry into the host cell. {ECO:0000269|PubMed:3608985}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Initiator methionine (1); Transmembrane (4) |
| Keywords |
Direct protein sequencing;Fusion of virus membrane with host membrane;Fusion of virus membrane with host outer membrane;Membrane;Reference proteome;Transmembrane;Transmembrane helix;Viral envelope protein;Viral penetration into host cytoplasm;Virion;Virus entry into host cell |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Virion membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
17,360 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|