Detail Information for IndEnz0002016166
IED ID IndEnz0002016166
Enzyme Type ID protease016166
Protein Name High frequency lysogenization protein HflD
Gene Name hflD ECIAI1_1170
Organism Escherichia coli O8 (strain IAI1)
Taxonomic Lineage cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli O8 (strain IAI1)
Enzyme Sequence MAKNYYDITLALAGICQSARLVQQLAHQGHCDADALHVSLNSIIDMNPSSTLAVFGGSEANLRVGLETLLGVLNASSRQGLNAELTRYTLSLMVLERKLSSAKGALDTLGNRINGLQRQLEHFDLQSETLMSAMAAIYVDVISPLGPRIQVTGSPAVLQSPQVQAKVRATLLAGIRAAVLWHQVGGGRLQLMFSRNRLTTQAKQILAHLTPEL
Enzyme Length 213
Uniprot Accession Number B7LX67
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Negative regulator of phage lambda lysogenization. Contributes to the degradation of the phage regulatory protein CII. Acts probably by holding CII on the membrane surface, away from the target promoters, but close to the FtsH protease. {ECO:0000255|HAMAP-Rule:MF_00695}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Coiled coil (1)
Keywords Cell inner membrane;Cell membrane;Coiled coil;Cytoplasm;Membrane
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Cytoplasm. Cell inner membrane {ECO:0000255|HAMAP-Rule:MF_00695}; Peripheral membrane protein {ECO:0000255|HAMAP-Rule:MF_00695}; Cytoplasmic side {ECO:0000255|HAMAP-Rule:MF_00695}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 22,948
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda