| IED ID | IndEnz0002016190 |
| Enzyme Type ID | protease016190 |
| Protein Name |
Protease HtpX EC 3.4.24.- Heat shock protein HtpX |
| Gene Name | htpX plu2681 |
| Organism | Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Morganellaceae Photorhabdus Photorhabdus laumondii Photorhabdus luminescens subsp. laumondii Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) |
| Enzyme Sequence | MMRIVLFLLTNLAVMLVFGIILSLTGIQGSSVQGLMIMAGLFGFGGAFVSLLMSKWMALRSVGGQVIEQPANEVEHWLVETVRSQAEQVNIAMPQVAIYAAPDINAFATGARRNASLVAVSSGLLDNMSRAEAEAVIAHEISHIANGDMVTMTLLQGIVNTFVIFISRLLAQAVSSFLSGNSDEEESNSSGNPIVYMVASMVLEIVFGILASIITMWFSRYREFHADAGSAKLVGREKMIAALQRLKTSYEPQEEGGMMAFCINGKSKTFSELFMSHPPLDKRIEALRSGQYLNK |
| Enzyme Length | 295 |
| Uniprot Accession Number | Q7N3N4 |
| Absorption | |
| Active Site | ACT_SITE 140; /evidence=ECO:0000255|HAMAP-Rule:MF_00188 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Metal binding (3); Transmembrane (4) |
| Keywords | Cell inner membrane;Cell membrane;Hydrolase;Membrane;Metal-binding;Metalloprotease;Protease;Reference proteome;Stress response;Transmembrane;Transmembrane helix;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000255|HAMAP-Rule:MF_00188}; Multi-pass membrane protein {ECO:0000255|HAMAP-Rule:MF_00188}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 32,079 |
| Kinetics | |
| Metal Binding | METAL 139; /note=Zinc; catalytic; /evidence=ECO:0000255|HAMAP-Rule:MF_00188; METAL 143; /note=Zinc; catalytic; /evidence=ECO:0000255|HAMAP-Rule:MF_00188; METAL 223; /note=Zinc; catalytic; /evidence=ECO:0000255|HAMAP-Rule:MF_00188 |
| Rhea ID | |
| Cross Reference Brenda |