| IED ID | IndEnz0002016202 |
| Enzyme Type ID | protease016202 |
| Protein Name |
Ovomucoid Fragment |
| Gene Name | |
| Organism | Struthio camelus (Common ostrich) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Palaeognathae Struthioniformes (ostriches) Struthionidae Struthio Struthio camelus (Common ostrich) |
| Enzyme Sequence | FATVDCSDYPKPVCPLDYMPLCGSDSKTYSNKCNFCNAVVESSGTLTLRHFGKC |
| Enzyme Length | 54 |
| Uniprot Accession Number | P05557 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Non-terminal residue (2); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Repeat;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: This is the only ovomucoid third domain known to be not glycosylated. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,915 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |