| IED ID | IndEnz0002016204 |
| Enzyme Type ID | protease016204 |
| Protein Name |
Wound-induced proteinase inhibitor 2 Wound-induced proteinase inhibitor II |
| Gene Name | |
| Organism | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum subgen. Lycopersicon Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
| Enzyme Sequence | MAVHKEVNFVAYLLIVLGMFLYVDAKACTRECGNLGFGICPRSEGSPLNPICINCCSGYKGCNYYNSFGKFICEGESDPKRPNACTFNCDPNIAYSRCPRSQGKSLIYPTGCTTCCTGYKGCYYFGKDGKFVCEGESDEPKANMYPVM |
| Enzyme Length | 148 |
| Uniprot Accession Number | P05119 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Potent inhibitor of both trypsin and chymotrypsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (11); Chain (1); Disulfide bond (8); Repeat (2); Signal peptide (1); Site (2); Turn (2) |
| Keywords | 3D-structure;Disulfide bond;Protease inhibitor;Reference proteome;Repeat;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | INDUCTION: Mechanical damage (i.e. insect chewing) to this plant results in the systemic release of a factor from the wound site. Within the leaves it induces the cytoplasmic synthesis of proteinase inhibitors I and II. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..25 |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 1OYV; 1PJU; |
| Mapped Pubmed ID | 12788916; |
| Motif | |
| Gene Encoded By | |
| Mass | 16,293 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |