| IED ID | IndEnz0002016207 |
| Enzyme Type ID | protease016207 |
| Protein Name |
Trypsin inhibitor A Kunitz-type trypsin inhibitor A |
| Gene Name | KTI3 |
| Organism | Glycine max (Soybean) (Glycine hispida) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Papilionoideae 50 kb inversion clade NPAAA clade indigoferoid/millettioid clade Phaseoleae Glycine Glycine subgen. Soja Glycine max (Soybean) (Glycine hispida) |
| Enzyme Sequence | MKSTIFFLFLFCAFTTSYLPSAIADFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISSPYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGWFRLERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKLDKESLAKKNHGLSRSE |
| Enzyme Length | 216 |
| Uniprot Accession Number | P01070 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibition of trypsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (17); Chain (1); Disulfide bond (2); Helix (2); Natural variant (1); Propeptide (1); Sequence conflict (1); Signal peptide (1); Site (1); Turn (2) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence="ECO:0000269|PubMed:3905784, ECO:0000269|PubMed:4734969, ECO:0000269|PubMed:8318586" |
| Structure 3D | X-ray crystallography (6) |
| Cross Reference PDB | 1AVU; 1AVW; 1AVX; 1BA7; 6NTT; 6O1F; |
| Mapped Pubmed ID | 20445958; 31585081; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,005 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |