| IED ID | IndEnz0002016250 |
| Enzyme Type ID | protease016250 |
| Protein Name |
Zingipain-2 EC 3.4.22.67 Cysteine proteinase GP-II |
| Gene Name | |
| Organism | Zingiber officinale (Ginger) (Amomum zingiber) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Zingiberales Zingiberaceae Zingiber Zingiber officinale (Ginger) (Amomum zingiber) |
| Enzyme Sequence | DDLPDSIDWRENGAVVPVKNQGGCGSCWAFSTVAAVEGINQIVTGDLISLSEQQLVDCTTANHGCRGGWMNPAFQFIVNNGGINSEETYPYRGQDGICNSTVNAPVVSIDSYENVPSHNEQSLQKAVANQPVSVTMDAAGRDFQLYRSGIFTGSCNISANHALTVVGYGTENDKDFWIVKNSWGKNWGESGYIRAERNIENPDGKCGITRFASYPVKKGTN |
| Enzyme Length | 221 |
| Uniprot Accession Number | P82474 |
| Absorption | |
| Active Site | ACT_SITE 27; /evidence=ECO:0000250; ACT_SITE 161; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage of peptides with a proline residue at the P2 position.; EC=3.4.22.67; |
| DNA Binding | |
| EC Number | 3.4.22.67 |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (8); Chain (1); Disulfide bond (3); Glycosylation (2); Helix (6); Turn (2) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Glycoprotein;Hydrolase;Protease;Thiol protease |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1CQD; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 23,922 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.22.67; |