| IED ID | IndEnz0002016273 |
| Enzyme Type ID | protease016273 |
| Protein Name |
Cysteine proteinase inhibitor 1 Oryzacystatin I OC-I Oryzacystatin-1 OsCP1 SPOC-I |
| Gene Name | Os01g0803200 LOC_Os01g58890 P0003D09.48 P0034E02.11 |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice) |
| Enzyme Sequence | MRKYRVAGLVAALLVLHSLATPSAQAEAHRAGGEGEEKMSSDGGPVLGGVEPVGNENDLHLVDLARFAVTEHNKKANSLLEFEKLVSVKQQVVAGTLYYFTIEVKEGDAKKLYEAKVWEKPWMDFKELQEFKPVDASANA |
| Enzyme Length | 140 |
| Uniprot Accession Number | P09229 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: There are two distinct cystatins in rice seeds (Oryzacystatin-1 and -2) with different specificities against cysteine proteinases. May be involved in the control of germination by inhibition of endogenous cysteine proteinases. May play a role in defense by inhibiting exogenous proteases such as those present in digestive tracks of insects and nematodes. {ECO:0000269|PubMed:1697595}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Beta strand (4); Chain (1); Domain (1); Erroneous initiation (6); Frameshift (1); Helix (1); Motif (1); Mutagenesis (1); Signal peptide (1); Site (1); Turn (1) |
| Keywords | 3D-structure;Alternative splicing;Direct protein sequencing;Plant defense;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000255 |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 1EQK; |
| Mapped Pubmed ID | 11472551; 1801735; 18943160; 19118651; 21638537; 25118653; 26267706; 27516765; 7785982; 8448364; 9538244; |
| Motif | MOTIF 91..95; /note=Secondary area of contact |
| Gene Encoded By | |
| Mass | 15,355 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |