| IED ID | IndEnz0002016279 |
| Enzyme Type ID | protease016279 |
| Protein Name |
Dickkopf-related protein 4 Dickkopf-4 Dkk-4 hDkk-4 Cleaved into: Dickkopf-related protein 4 short form |
| Gene Name | DKK4 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL |
| Enzyme Length | 224 |
| Uniprot Accession Number | Q9UBT3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (6); Chain (2); Compositional bias (1); Disulfide bond (5); Helix (1); Region (3); Sequence conflict (1); Signal peptide (1); Turn (2) |
| Keywords | 3D-structure;Cleavage on pair of basic residues;Developmental protein;Direct protein sequencing;Disulfide bond;Reference proteome;Secreted;Signal;Wnt signaling pathway |
| Interact With | Q96F15; P11215; Q96CV9; Q5TGU0 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: Appears to be not glycosylated.; PTM: Can be proteolytically processed by a furin-like protease. {ECO:0000269|PubMed:10570958}. |
| Signal Peptide | SIGNAL 1..18; /evidence="ECO:0000269|PubMed:10570958, ECO:0000269|PubMed:15340161" |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 5O57; |
| Mapped Pubmed ID | 11029007; 11137016; 11357136; 11433302; 11448771; 11701963; 11742004; 12050670; 12167704; 12205098; 12527209; 12897152; 15084453; 15459103; 17047023; 17553464; 18044981; 18408752; 18461655; 18502762; 18606139; 19059704; 19158955; 19453261; 19562778; 19659606; 19773279; 20053636; 20093360; 20650998; 21341386; 21944579; 21984209; 21994129; 22000855; 22000856; 22216841; 22249261; 22653731; 22740476; 23108157; 23256519; 23516639; 23791946; 23958302; 26419038; 26880586; 27272409; 28005267; 28450117; 28666421; 29925589; 31202458; 32713860; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,876 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |