| IED ID | IndEnz0002016281 |
| Enzyme Type ID | protease016281 |
| Protein Name |
Serine protease inhibitor dipetalogastin Dipetalin Fragment |
| Gene Name | |
| Organism | Dipetalogaster maximus (Blood-sucking bug) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Paraneoptera Hemiptera Prosorrhyncha (bugs) Heteroptera (true bugs) Euheteroptera Neoheteroptera Panheteroptera Cimicomorpha Reduvioidea Reduviidae (assassin bugs) Triatominae (kissing bugs) Dipetalogaster Dipetalogaster maximus (Blood-sucking bug) |
| Enzyme Sequence | LIKELVNMVIQHAEEEEVKELKNPCECPRALHRVCGSDGNTYSNPCMLNCAKHEGNPDLVQVHKGPCDEHDHDFEDPCKCDNKFEPVCGDDQITYLNLCHLECATFTTSPGVEVAYEGECHAETTNAMEVLFQGNPCECPRALHRVCGSDGNTYSNPCMLTCAKHEGNPDLVQVHEGPCDEHDHDFEDTCQCDDTFQPVCGDDEITYRNLCHLECATFTTSPGVEVKHEGECHPETKVNQLILKSCMCPKIYKPVCGTDGRTYPNICVLKCHISSNPGLGLAHLGECKVAVLAKETGEVRNPCNCFRNFNPVCGTDGKTYGNLCMLGCAAETKVPGLKLLHNGRCLPKEQL |
| Enzyme Length | 351 |
| Uniprot Accession Number | O96790 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Thrombin inhibitor. Prevents blood clotting to allow insect to feed on blood. Also functions as an inhibitor of trypsin and plasmin. {ECO:0000269|PubMed:10561601, ECO:0000269|PubMed:10702701, ECO:0000269|PubMed:12051857}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Disulfide bond (18); Domain (6); Erroneous initiation (1); Helix (1); Non-terminal residue (1); Propeptide (1); Site (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Protease inhibitor;Repeat;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 1KMA; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 38,690 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |