IED ID | IndEnz0002016305 |
Enzyme Type ID | protease016305 |
Protein Name |
Inter-alpha-trypsin inhibitor ITI GIK-14 Inhibitory fragment of ITI Fragment |
Gene Name | |
Organism | Capra hircus (Goat) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Caprinae Capra Capra hircus (Goat) |
Enzyme Sequence | KEDSCQLGYSQGPCLGMFKRYFYNGTSMACETFYYGGCMGNGNNFPSEKECLQTCRTVQACNLPIVRGPCRAGIELWAFDAVKGKCVRFIYGGCNGNGNQFYSQKECKEYCGIPGEADEELLR |
Enzyme Length | 123 |
Uniprot Accession Number | P62756 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: This inhibitory fragment, released from native ITI after limited proteolysis with trypsin, contains two homologous domains. Whereas the second domain is a strong inhibitor of trypsin, the first domain interacts weakly with PMN-granulocytic elastase and not at all with pancreatic elastase. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Disulfide bond (6); Domain (2); Glycosylation (1); Non-terminal residue (2); Site (2) |
Keywords | Direct protein sequencing;Disulfide bond;Glycoprotein;Protease inhibitor;Reference proteome;Repeat;Secreted;Serine protease inhibitor |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 13,687 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |