| IED ID | IndEnz0002016312 |
| Enzyme Type ID | protease016312 |
| Protein Name |
Trypsin inhibitor 2 OsTI 2 |
| Gene Name | |
| Organism | Opuntia streptacantha (Prickly pear cactus) (Opuntia cardona) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae Caryophyllales Cactineae Cactaceae Opuntioideae Opuntia Opuntia streptacantha (Prickly pear cactus) (Opuntia cardona) |
| Enzyme Sequence | QQCAERGQSCNPYEGIECCGDILCIQPRIWPPVPGRCA |
| Enzyme Length | 38 |
| Uniprot Accession Number | P86388 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits trypsin-like proteases from the guts of the insect pests P.truncatus, P.americana, Acheta sp and Gryllus sp. {ECO:0000269|PubMed:19765785}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Thermostable. 10% inactivation is seen after incubation at 95 degrees Celsius for 2 hours at pH 9.0. Retains activity after incubation at 120 degrees Celsius for 1 hour at pH 3.0 and pH 7.0, but at pH 9.0 40% of the activity is lost. {ECO:0000269|PubMed:19765785}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 8.0. Alkaline pH values decrease the thermostability of this inhibitor. {ECO:0000269|PubMed:19765785}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Modified residue (1); Sequence uncertainty (3) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Pyrrolidone carboxylic acid;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | MOD_RES 1; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:19765785 |
| Post Translational Modification | PTM: Contains disulfide bonds. {ECO:0000269|PubMed:19765785}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 4,192 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |