| IED ID | IndEnz0002016349 |
| Enzyme Type ID | protease016349 |
| Protein Name |
Signal peptidase I P SPase I EC 3.4.21.89 Leader peptidase I |
| Gene Name | sipP sipP40 |
| Organism | Bacillus subtilis subsp. natto |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. natto |
| Enzyme Sequence | MFDKEKRKKSNIIDWIKAILIALILVFLVRTFLFEPYIVQGESMKPTLFNSERLFVNKFVKYTGDFKRGDIVVLNGEEKKTHYVKRLIGLPGDTIEMKNDNLFVNGKRFNEEYLKENKKDAHDSDLNLTGDFGPIKVPKDKYFVMGDNRQNSMDSRNGLGLFNKKDIVGVEELVFFPLDRIRHAK |
| Enzyme Length | 185 |
| Uniprot Accession Number | Q57350 |
| Absorption | |
| Active Site | ACT_SITE 43; /evidence=ECO:0000250; ACT_SITE 85; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins.; EC=3.4.21.89; |
| DNA Binding | |
| EC Number | 3.4.21.89 |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Topological domain (2); Transmembrane (1) |
| Keywords | Cell membrane;Hydrolase;Membrane;Plasmid;Protease;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | Plasmid pTA1040 |
| Mass | 21,568 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |