| IED ID | IndEnz0002016413 |
| Enzyme Type ID | protease016413 |
| Protein Name |
Colicin-V Microcin-V bacteriocin |
| Gene Name | cvaC |
| Organism | Escherichia coli |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli |
| Enzyme Sequence | MRTLTLNELDSVSGGASGRDIAMAIGTLSGQFVAGGIGAAAGGVAGGAIYDYASTHKPNPAMSPSGLGGTIKQKPEGIPSEAWNYAAGRLCNWSPNNLSDVCL |
| Enzyme Length | 103 |
| Uniprot Accession Number | P22522 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Colicin V kills sensitive cells by disrupting the membrane potential.; FUNCTION: Colicins are polypeptide toxins produced by, and active against E.coli and closely related bacteria. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Propeptide (1) |
| Keywords | Antibiotic;Antimicrobial;Bacteriocin;Direct protein sequencing;Disulfide bond;Plasmid;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:8204625}. Note=Secreted by the CvaAB/TolC export system. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | Plasmid IncFI ColV3-K30 |
| Mass | 10,311 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |