| IED ID | IndEnz0002016426 |
| Enzyme Type ID | protease016426 |
| Protein Name |
Disulfide bond formation protein B Disulfide oxidoreductase |
| Gene Name | dsbB |
| Organism | Burkholderia cepacia (Pseudomonas cepacia) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Betaproteobacteria Burkholderiales Burkholderiaceae Burkholderia Burkholderia cepacia complex Burkholderia cepacia (Pseudomonas cepacia) |
| Enzyme Sequence | MNDYTLALRRERRLLMLLGWVCIALLAGALYLQYVKNEDPCPLCIIQRYFFCAIGIFAFVAAGIRNWRGVWVLELLIAIAAAGGVGTAARHLSIQMNPGFSCGFDTLQPIVDSLPPAQWFPGMFKVAGLCETVYPPIFGILLPGWALIGFAVILVAVVASLWRHRRKLAS |
| Enzyme Length | 170 |
| Uniprot Accession Number | P94287 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Required for disulfide bond formation in some periplasmic proteins. Acts by oxidizing the DsbA protein (By similarity). Required for the production of extracellular protease. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Topological domain (5); Transmembrane (4) |
| Keywords | Cell inner membrane;Cell membrane;Chaperone;Disulfide bond;Electron transport;Membrane;Oxidoreductase;Redox-active center;Transmembrane;Transmembrane helix;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 18,765 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |