| IED ID | IndEnz0002016446 |
| Enzyme Type ID | protease016446 |
| Protein Name |
D-dopachrome decarboxylase EC 4.1.1.84 D-dopachrome tautomerase |
| Gene Name | Ddt |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MPFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLISSIGVVGTAEQNRSHSSSFFKFLTEELSLDQDRIIIRFFPLEPWQIGKKGTVMTFL |
| Enzyme Length | 118 |
| Uniprot Accession Number | P80254 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=D-dopachrome + H(+) = 5,6-dihydroxyindole + CO2; Xref=Rhea:RHEA:18441, ChEBI:CHEBI:15378, ChEBI:CHEBI:16526, ChEBI:CHEBI:27404, ChEBI:CHEBI:58782; EC=4.1.1.84; |
| DNA Binding | |
| EC Number | 4.1.1.84 |
| Enzyme Function | FUNCTION: Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI). |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Initiator methionine (1); Modified residue (3) |
| Keywords | Acetylation;Cytoplasm;Direct protein sequencing;Lyase;Melanin biosynthesis;Phosphoprotein;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. |
| Modified Residue | MOD_RES 2; /note=N-acetylproline; /evidence=ECO:0000250|UniProtKB:O35215; MOD_RES 33; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:O35215; MOD_RES 90; /note=Phosphoserine; /evidence=ECO:0007744|PubMed:22673903 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 13,133 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:18441 |
| Cross Reference Brenda | 4.1.1.84;5.3.3.12; |