| IED ID | IndEnz0002016483 |
| Enzyme Type ID | protease016483 |
| Protein Name |
Clitocypin-4/-3 Cysteine protease inhibitor clt4/clt3 |
| Gene Name | clt4 clt3 |
| Organism | Clitocybe nebularis (Clouded agaric) (Lepista nebularis) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Basidiomycota Agaricomycotina Agaricomycetes Agaricomycetidae Agaricales Tricholomataceae Clitocybe Clitocybe nebularis (Clouded agaric) (Lepista nebularis) |
| Enzyme Sequence | MASLEDGTYRLRAVTTSNPDPGVGGEYATVEGARQPVKAEPSTPPFFERQIWQVTRNADGQYTIKYQGLNAPFEYGFSYDQLEQNAPVIAGDPKEYILQLVPSTTDVYIIRAPIQRVGVDVEVGVQGNNLVYKFFPVDGSGGDRPAWRFTRE |
| Enzyme Length | 152 |
| Uniprot Accession Number | Q3Y9I2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Binds and inhibits cysteine proteinases. Inhibits most strongly papain and cathepsin L, more weakly bromelain and cathepsin B while it is completely ineffective against cathepsin H. {ECO:0000250|UniProtKB:Q9P4A2}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Protease inhibitor;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Note=Not secreted. {ECO:0000250|UniProtKB:Q9P4A2}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,893 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |